Neuroserpin (Serpini1) Recombinant Protein | Serpini1 recombinant protein

Recombinant Mouse Neuroserpin (Serpini1)

Cat. Num. AAA1027244

• Gene Names: Serpini1; Ns; PI12; PI-12; Spi17; AI837402
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Neuroserpin (Serpini1); Recombinant Mouse Neuroserpin (Serpini1); Serpini1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 17-410, Full length protein
• Sequence: TGATFPDETITEWSVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKSCIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPETMNTSGHDFEEL
• Sequence Length: 394

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Serpini1 recombinant protein

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 6678091
• NCBI GeneID: 20713
• NCBI Accession #: NP_033276.1
• NCBI GenBank Nucleotide #: NM_009250.3
• UniProt Accession #: O35684; Q543F7; Q922U6
• Molecular Weight: 46,348 Da
• NCBI Official Full Name: neuroserpin isoform 1
• NCBI Official Synonym Full Names: serine (or cysteine) peptidase inhibitor, clade I, member 1
• NCBI Official Symbol: Serpini1
• NCBI Official Synonym Symbols: Ns; PI12; PI-12; Spi17; AI837402
• NCBI Protein Information: neuroserpin
• UniProt Protein Name: Neuroserpin
• Protein Family: Neuroserpin
• UniProt Gene Name: Serpini1
• UniProt Synonym Gene Names: Pi12; Spi17; PI-12

Uniprot Description

Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9364046, PubMed:11557034). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable).