Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sphingolipid delta (4)-desaturase DES1 (Degs1) Recombinant Protein | Degs1 recombinant protein

Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1)

Gene Names
Degs1; Degs; Des1; Mdes; AA536663
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sphingolipid delta (4)-desaturase DES1 (Degs1); Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1); Recombinant Sphingolipid delta (4)-desaturase DES1 (Degs1); Sphingolipid delta(4)-desaturase DES1 EC= 1.14.-.-; Degenerative spermatocyte homolog 1; Degs1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-323
Sequence
GSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFVTDDTISPYSRMKRPPKGNEILE
Sequence Length
323
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,241 Da
NCBI Official Full Name
sphingolipid delta(4)-desaturase DES1
NCBI Official Synonym Full Names
degenerative spermatocyte homolog 1 (Drosophila)
NCBI Official Symbol
Degs1
NCBI Official Synonym Symbols
Degs; Des1; Mdes; AA536663
NCBI Protein Information
sphingolipid delta(4)-desaturase DES1; sphingolipid delta(4)-desaturase DES1; dihydroceramide desaturase
UniProt Protein Name
Sphingolipid delta(4)-desaturase DES1
UniProt Gene Name
Degs1
UniProt Synonym Gene Names
Degs; Des1; Mdes
UniProt Entry Name
DEGS1_MOUSE

Uniprot Description

DEGS1: Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine). Belongs to the fatty acid desaturase family. DEGS subfamily.

Protein type: Membrane protein, integral; EC 1.14.-.-; Oxidoreductase; Membrane protein, multi-pass; Lipid Metabolism - sphingolipid

Cellular Component: mitochondrion; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: tert-butyl alcohol 2-monooxygenase activity; methylsilanetriol hydroxylase activity; alpha-pinene dehydrogenase activity; hydroxymethylsilanetriol oxidase activity; oxidoreductase activity; fluorene oxygenase activity; tri-n-butyltin dioxygenase activity; 2-hydroxyisobutyrate 3-monooxygenase activity; 4-nitrocatechol 4-monooxygenase activity; alpha-pinene monooxygenase activity; spheroidene monooxygenase activity; dimethylsilanediol hydroxylase activity; ammonia monooxygenase activity; mono-butyltin dioxygenase activity; 4-chlorophenoxyacetate monooxygenase activity; methyl tertiary butyl ether 3-monooxygenase activity; sphingolipid delta-4 desaturase activity; di-n-butyltin dioxygenase activity

Biological Process: sphingolipid biosynthetic process; positive regulation of apoptosis; ceramide biosynthetic process; lipid metabolic process; fatty acid metabolic process; fatty acid biosynthetic process

Research Articles on Degs1

Similar Products

Product Notes

The Degs1 degs1 (Catalog #AAA1016321) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-323. The amino acid sequence is listed below: GSRVSREEFE WVYTDQPHAA RRKEILAKYP EIKSLMKPDH NLIWIVAMML LVQLASFYLV KDLDWKWVIF WSYVFGSCLN HSMTLAIHEI SHNFPFGHHK ALWNRWFGMF ANLSLGVPYS ISFKRYHMDH HRYLGADKID VDIPTDFEGW FFCTTFRKFV WVILQPLFYA FRPLFINPKP ITYLEIINTV IQITFDIIIY YVFGVKSLVY MLAATLLGLG LHPISGHFIA EHYMFLKGHE TYSYYGPLNL LTFNVGYHNE HHDFPNVPGK NLPMVRKIAS EYYDDLPHYN SWIKVLYDFV TDDTISPYSR MKRPPKGNEI LE. It is sometimes possible for the material contained within the vial of "Sphingolipid delta (4)-desaturase DES1 (Degs1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.