Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein RER1 (RER1) Recombinant Protein | RER1 recombinant protein

Recombinant Human Protein RER1 (RER1)

Gene Names
RER1; RP4-740C4.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein RER1 (RER1); Recombinant Human Protein RER1 (RER1); Recombinant Protein RER1 (RER1); Protein RER1; RER1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-196
Sequence
MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS
Sequence Length
196
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,958 Da
NCBI Official Full Name
protein RER1
NCBI Official Synonym Full Names
RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)
NCBI Official Symbol
RER1
NCBI Official Synonym Symbols
RP4-740C4.2
NCBI Protein Information
protein RER1
UniProt Protein Name
Protein RER1
Protein Family
UniProt Gene Name
RER1
UniProt Entry Name
RER1_HUMAN

NCBI Description

The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009]

Uniprot Description

RER1: Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment. Belongs to the RER1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: Golgi apparatus; cell surface; ER-Golgi intermediate compartment; integral to Golgi membrane

Molecular Function: acetylcholine receptor binding

Biological Process: retrograde vesicle-mediated transport, Golgi to ER

Research Articles on RER1

Similar Products

Product Notes

The RER1 rer1 (Catalog #AAA1005248) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196. The amino acid sequence is listed below: MSEGDSVGES VHGKPSVVYR FFTRLGQIYQ SWLDKSTPYT AVRWVVTLGL SFVYMIRVYL LQGWYIVTYA LGIYHLNLFI AFLSPKVDPS LMEDSDDGPS LPTKQNEEFR PFIRRLPEFK FWHAATKGIL VAMVCTFFDA FNVPVFWPIL VMYFIMLFCI TMKRQIKHMI KYRYIPFTHG KRRYRGKEDA GKAFAS. It is sometimes possible for the material contained within the vial of "Protein RER1 (RER1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.