High-affinity zinc uptake system membrane protein znuB (znuB) Recombinant Protein | znuB recombinant protein
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum High-affinity zinc uptake system membrane protein znuB (znuB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High-affinity zinc uptake system membrane protein znuB (znuB); Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum High-affinity zinc uptake system membrane protein znuB (znuB); Recombinant High-affinity zinc uptake system membrane protein znuB (znuB); High-affinity zinc uptake system membrane protein znuB; znuB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-262
Sequence
MFELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNINSFYAILILMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDLLSVTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVLYARLTIMLMTAFTIAIAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPASPSIVLCSSFLCLISNIKKHFY
Sequence Length
262
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,547 Da
NCBI Official Full Name
high-affinity zinc uptake system membrane protein ZnuB
NCBI Official Symbol
znuB
NCBI Protein Information
high-affinity zinc uptake system membrane protein ZnuB
UniProt Protein Name
High-affinity zinc uptake system membrane protein ZnuB
Protein Family
UniProt Gene Name
znuB
UniProt Entry Name
ZNUB_BUCAI
Uniprot Description
Function: Involved in the high-affinity zinc uptake transport system
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Probable.
Sequence similarities: Belongs to the ABC-3 integral membrane protein family.
Similar Products
Product Notes
The znuB znub (Catalog #AAA1003524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-262. The amino acid sequence is listed below: MFELIFPGWL AGVLLSLTTG PLGSFIVWRR MSSFGDTLSH SSLLGIALSI AFNINSFYAI LILMSFIAII LAWLEELLPV SLDTVLNIIS HSSLSLGMVF ISLISSKKEI NITNYLFGDL LSVTKNDLIT ISISSILILS ILLFRWHSIL SSTINEELSQ IDGINVLYAR LTIMLMTAFT IAIAIKFVGA LLITSLLIIP PATAQHFSGS PEKMVIIAII VSILSVTGGI SLSVFYNTPA SPSIVLCSSF LCLISNIKKH FY. It is sometimes possible for the material contained within the vial of "High-affinity zinc uptake system membrane protein znuB (znuB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
