DNA polymerase accessory protein 44 (44) Recombinant Protein | 44 recombinant protein
Recombinant Enterobacteria phage T4 DNA polymerase accessory protein 44 (44)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA polymerase accessory protein 44 (44); Recombinant Enterobacteria phage T4 DNA polymerase accessory protein 44 (44); 44 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-319, Full length protein
Sequence
MITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Sequence Length
319
Species
Enterobacteria phage T4 (Bacteriophage T4)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,786 Da
NCBI Official Full Name
gp44 clamp loader subunit, DNA polymerase accessory protein
NCBI Official Symbol
44
NCBI Protein Information
clamp loader, small subunit
UniProt Protein Name
Sliding-clamp-loader gp44 subunit
UniProt Gene Name
44
UniProt Synonym Gene Names
gp44
Uniprot Description
Function as a sliding-clamp-loading ATPase enzyme during DNA replication. Required for elongation of primed templates by controlling the polymerase processivity. Possesses DNA-dependent ATPase activity on its own and within the heterodimer gp44/gp62. Progressive binding of ATPs triggers a conformational change in the complex that inhibits ATPase activity.
Research Articles on 44
Similar Products
Product Notes
The 44 44 (Catalog #AAA1089785) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-319, Full length protein. The amino acid sequence is listed below: MITVNEKEHI LEQKYRPSTI DECILPAFDK ETFKSITSKG KIPHIILHSP SPGTGKTTVA KALCHDVNAD MMFVNGSDCK IDFVRGPLTN FASAASFDGR QKVIVIDEFD RSGLAESQRH LRSFMEAYSS NCSIIITANN IDGIIKPLQS RCRVITFGQP TDEDKIEMMK QMIRRLTEIC KHEGIAIADM KVVAALVKKN FPDFRKTIGE LDSYSSKGVL DAGILSLVTN DRGAIDDVLE SLKNKDVKQL RALAPKYAAD YSWFVGKLAE EIYSRVTPQS IIRMYEIVGE NNQYHGIAAN TELHLAYLFI QLACEMQWK. It is sometimes possible for the material contained within the vial of "DNA polymerase accessory protein 44 (44), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
