Sensor protein ZraS (zraS) Recombinant Protein | zraS recombinant protein
Recombinant Escherichia coli Sensor protein ZraS (zraS)
Gene Names
zraS; ECK3995; hydH; JW3967
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sensor protein ZraS (zraS); Recombinant Escherichia coli Sensor protein ZraS (zraS); zraS recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-465aa; full length protein
Sequence
MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRASEADRQALLEKGNVLIRAL ESGSRVGMGMRMHHVQQQALLEEMAGQPGVLWFAVTDAQGIIILHSDPDKVGRALYSPDE MQKLKPEENSRWRLLGKTETTPALEVYRLFQPMSAPWRHGMHNMPRCNGKAVPQVDAQQA IFIAVDASDLVATQSGEKRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKE KLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSE LLELVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQV LLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLDAIFTPYFTTKAEGT GLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPVNITRKDPQG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for zraS recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,032 Da
NCBI Official Full Name
sensory histidine kinase in two-component regulatory system with ZraR
NCBI Official Symbol
zraS
NCBI Official Synonym Symbols
ECK3995; hydH; JW3967
NCBI Protein Information
sensory histidine kinase in two-component regulatory system with ZraR
UniProt Protein Name
Sensor protein ZraS
Protein Family
UniProt Gene Name
zraS
UniProt Synonym Gene Names
hydH
UniProt Entry Name
ZRAS_ECOLI
NCBI Description
ZraS belongs to the two component system ZraS/ZraR , is a sensor-histidine kinase and is known to be a transmembrane protein composed of three domains: external sensory domain (amino-terminal), cytoplasmic transmitter domain (carboxyl-terminal) and transmembrane hydrofobic central domain (unknown funtion). [More information is available at EcoCyc: EG10008].
Uniprot Description
Member of the two-component regulatory system ZraS/ZraR. May function as a membrane-associated protein kinase that phosphorylates ZraR in response to high concentrations of zinc or lead in the medium.
Similar Products
Product Notes
The zraS zras (Catalog #AAA7035812) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-465aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the zraS zras for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRFMQRSKDS LAKWLSAILP VVIVGLVGLF AVTVIRDYGR ASEADRQALL EKGNVLIRAL ESGSRVGMGM RMHHVQQQAL LEEMAGQPGV LWFAVTDAQG IIILHSDPDK VGRALYSPDE MQKLKPEENS RWRLLGKTET TPALEVYRLF QPMSAPWRHG MHNMPRCNGK AVPQVDAQQA IFIAVDASDL VATQSGEKRN TLIILFALAT VLLASVLSFF WYRRYLRSRQ LLQDEMKRKE KLVALGHLAA GVAHEIRNPL SSIKGLAKYF AERAPAGGEA HQLAQVMAKE ADRLNRVVSE LLELVKPTHL ALQAVDLNTL INHSLQLVSQ DANSREIQLR FTANDTLPEI QADPDRLTQV LLNLYLNAIQ AIGQHGVISV TASESGAGVK ISVTDSGKGI AADQLDAIFT PYFTTKAEGT GLGLAVVHNI VEQHGGTIQV ASQEGKGSTF TLWLPVNITR KDPQG. It is sometimes possible for the material contained within the vial of "Sensor protein ZraS (zraS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
