Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zona pellucida sperm-binding protein 3 Recombinant Protein | ZP3 recombinant protein

Zona pellucida sperm-binding protein 3

Gene Names
ZP3; ZPC; Zp-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zona pellucida sperm-binding protein 3; ZP3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-332aa; full length protein
Sequence
QPVWQDEGQRLRPSKPPTVMVECQEAQLVVIVSKDLFGTGKLIRPADLSLGPAKCEPLVSQDTDAVVRFEVGLHECGSSLQVTDDALVYSTFLRHDPRPAGNLSILRTNRAEVPIECHYPRQGNVSSWAILPTWVPFRTTVFSEEKLVFSLRLMEENWSAEKMTPTFQLGDRAHLQAQVHTGSHVPLRLFVDHCVATLTPDWNTSPSHTIVDFHGCLVDGLTEASSAFKAPRPGPETLQFTVDVFHFANDSRNTIYITCHLKVTPADRVPDQLNKACSFSKSSNRWSPVEGPAVICRCCHKGQCGTPSLSRKLSMPKRQSAPRSRRHVTDEA
Sequence Length
Full Length Protein
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ZP3 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ZP3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,239 Da
NCBI Official Full Name
zona pellucida sperm-binding protein 3
NCBI Official Symbol
ZP3
NCBI Official Synonym Symbols
ZPC; Zp-3
NCBI Protein Information
zona pellucida sperm-binding protein 3
UniProt Protein Name
Zona pellucida sperm-binding protein 3
UniProt Gene Name
ZP3
UniProt Synonym Gene Names
ZP3B; ZPC; Zp-3; Zp-3-beta; Zp3-beta
UniProt Entry Name
ZP3_PIG

Uniprot Description

The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for zona matrix formation. In pig, does not seem to have a sperm-binding activity by itself but may increase sperm-binding activity of ZPB.

Research Articles on ZP3

Similar Products

Product Notes

The ZP3 zp3 (Catalog #AAA7043582) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-332aa; full length protein. The amino acid sequence is listed below: QPVWQDEGQR LRPSKPPTVM VECQEAQLVV IVSKDLFGTG KLIRPADLSL GPAKCEPLVS QDTDAVVRFE VGLHECGSSL QVTDDALVYS TFLRHDPRPA GNLSILRTNR AEVPIECHYP RQGNVSSWAI LPTWVPFRTT VFSEEKLVFS LRLMEENWSA EKMTPTFQLG DRAHLQAQVH TGSHVPLRLF VDHCVATLTP DWNTSPSHTI VDFHGCLVDG LTEASSAFKA PRPGPETLQF TVDVFHFAND SRNTIYITCH LKVTPADRVP DQLNKACSFS KSSNRWSPVE GPAVICRCCH KGQCGTPSLS RKLSMPKRQS APRSRRHVTD EA. It is sometimes possible for the material contained within the vial of "Zona pellucida sperm-binding protein 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.