Zona pellucida sperm-binding protein 2 (ZP2) Recombinant Protein | ZP2 recombinant protein

Recombinant Cat Zona pellucida sperm-binding protein 2 (ZP2)

Cat. Num. AAA961140

• Gene Names: ZP2; ZPA; Zp-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zona pellucida sperm-binding protein 2 (ZP2); Recombinant Cat Zona pellucida sperm-binding protein 2 (ZP2); Recombinant Zona pellucida sperm-binding protein 2 (ZP2); Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; Zp-2 Zona pellucida protein A Cleaved into the following chain: 1. Processed zona pellucida sperm-binding protein 2; ZP2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 370-636; ZP domain.
• Sequence: LCTQDGFMDIKVYSHQTKPALNLETLRVGDSSCQPTFQAASQGLILFHIPLNGCGTRHKFKEGKVIYENEIHAVWADLPPSTISRDSEFRMTVQCHYSKGDLLINTRVQSLPPLEASVRPGPLALILQTYPDKSYLQPYGEKEYPVVRYLRQPIYLEVRVLNRSDPNIKLVLDDCWATPTMDPASVPQWNIIMDGCEYNLDNHRTTFHPVGSSVTYPTHYRRFDVKTFAFVSEAQVLSSLVYFHCSVLICSRLSADSPLCSVTCPVS
• Sequence Length: 636

• Species: Felis catus (Cat) (Felis silvestris catus)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Related Product Information for ZP2 recombinant protein

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. This protein is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.

NCBI and Uniprot Product Information

• NCBI GI #: 57619134
• NCBI GeneID: 493977
• NCBI Accession #: NP_001009875.1
• NCBI GenBank Nucleotide #: NM_001009875.1
• UniProt Accession #: P47984
• Molecular Weight: 80,136 Da
• NCBI Official Full Name: zona pellucida sperm-binding protein 2
• NCBI Official Symbol: ZP2
• NCBI Official Synonym Symbols: ZPA; Zp-2
• NCBI Protein Information: zona pellucida sperm-binding protein 2; zona pellucida protein A; zona pellucida glycoprotein ZP2
• UniProt Protein Name: Zona pellucida sperm-binding protein 2
• Protein Family: Zona pellucida sperm-binding protein
• UniProt Gene Name: ZP2
• UniProt Synonym Gene Names: ZPA; Zp-2
• UniProt Entry Name: ZP2_FELCA

Uniprot Description

Function: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor.

Subunit structure: Polymers of ZP2 and ZP3 organized into long filaments cross-linked by ZP1 homodimers

By similarity.

Subcellular location: Processed zona pellucida sperm-binding protein 2: Secreted › extracellular space › extracellular matrix. Cell membrane; Single-pass type I membrane protein.

Tissue specificity: Oocytes.

Domain: The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.

Post-translational modification: Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.Proteolytically cleaved in the N-terminal part probably by the metalloendopeptidase ASTL exocytosed from cortical granules after fertilization, yielding a N-terminal peptide of about 30 kDa which remains covalently attached to the C-terminal peptide via disulfide bond(s). This cleavage may play an important role in the post-fertilization block to polyspermy. Additional proteolytically cleavage of the N-terminal peptide of 30 kDa occurs in one-cell and two-cell embryos

By similarity.Contains disulfide bond(s)

By similarity.N-glycosylated

By similarity.O-glycosylated; contains sulfate-substituted glycans

By similarity.

Sequence similarities: Belongs to the ZP domain family. ZPA subfamily.Contains 1 ZP domain.