Probable zinc transport system zinc-binding lipoprotein AdcA (adcA) Recombinant Protein | adcA recombinant protein
Recombinant Bacillus subtilis Probable zinc transport system zinc-binding lipoprotein AdcA (adcA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable zinc transport system zinc-binding lipoprotein AdcA (adcA); Recombinant Bacillus subtilis Probable zinc transport system zinc-binding lipoprotein AdcA (adcA); adcA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-319, Full length protein
Sequence
CGNSSTKGSADSKGDKLHVVTTFYPMYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHAVFVNASKGIDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTEVLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLVKS
Sequence Length
299
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,660 Da
NCBI Official Full Name
zinc transport system zinc-binding lipoprotein AdcA
NCBI Official Symbol
adcA
NCBI Protein Information
zinc transport system zinc-binding lipoprotein AdcA
UniProt Protein Name
High-affinity zinc uptake system binding-protein ZnuA
Protein Family
UniProt Gene Name
znuA
UniProt Synonym Gene Names
adcA; ycdH
Uniprot Description
Part of the high-affinity ABC transporter complex ZnuABC involved in zinc import (Probable). ZnuABC-mediated zinc transport is required for comF expression and competence development.
Similar Products
Product Notes
The adcA znua (Catalog #AAA1032570) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-319, Full length protein. The amino acid sequence is listed below: CGNSSTKGSA DSKGDKLHVV TTFYPMYEFT KQIVKDKGDV DLLIPSSVEP HDWEPTPKDI ANIQDADLFV YNSEYMETWV PSAEKSMGQG HAVFVNASKG IDLMEGSEEE HEEHDHGEHE HSHAMDPHVW LSPVLAQKEV KNITAQIVKQ DPDNKEYYEK NSKEYIAKLQ DLDKLYRTTA KKAEKKEFIT QHTAFGYLAK EYGLKQVPIA GLSPDQEPSA ASLAKLKTYA KEHNVKVIYF EEIASSKVAD TLASEIGAKT EVLNTLEGLS KEEQDKGLGY IDIMKQNLDA LKDSLLVKS. It is sometimes possible for the material contained within the vial of "Probable zinc transport system zinc-binding lipoprotein AdcA (adcA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
