Zinc finger protein 431 (ZNF431) Recombinant Protein | ZNF431 recombinant protein
Recombinant Human Zinc finger protein 431 (ZNF431)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 431 (ZNF431); Recombinant Human Zinc finger protein 431 (ZNF431); ZNF431 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-576, Full length protein
Sequence
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLYMNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQDIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDKYVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKAFKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLTKHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKMIHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL
Sequence Length
576
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67,217 Da
NCBI Official Full Name
zinc finger protein 431 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 431
NCBI Official Symbol
ZNF431
NCBI Protein Information
zinc finger protein 431
UniProt Protein Name
Zinc finger protein 431
Protein Family
UniProt Gene Name
ZNF431
UniProt Synonym Gene Names
KIAA1969
NCBI Description
This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein may negatively regulate transcription of target genes, including the hedgehog signaling pathway receptor patched 1, by interacting with histone deacetylases. Mutations in this gene may be associated with non-syndromic facial clefting in human patients. [provided by RefSeq, Jul 2016]
Uniprot Description
Sequence-specific DNA binding transcriptional repressor. Represses target gene transcription by recruiting HDAC1 and HDAC2 histone deacetylases. Acts as a specific transcriptional repressor for PTCH1 during embryonic development. Required for osteoblast differentiation and sonic hedgehog/SHH signaling response. Binds to the consensus site 5'-GCGCCC-3' in the promoter of PTCH1 ().
Similar Products
Product Notes
The ZNF431 znf431 (Catalog #AAA7058126) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-576, Full length protein. The amino acid sequence is listed below: MDDLKYGVYP LKEASGCPGA ERNLLVYSYF EKETLTFRDV AIEFSLEEWE CLNPAQQNLY MNVMLENYKN LVFLGVAVSK QDPVTCLEQE KEPWNMKRHE MVDEPPAMCS YFTKDLWPEQ DIKDSFQQVI LRRYGKCEHE NLQLRKGSAS VDEYKVHKEG YNELNQCLTT TQSKIFPCDK YVKVFHKFLN ANRHKTRHTG KKPFKCKKCG KSFCMLLHLS QHKRIHIREN SYQCEECGKA FKWFSTLTRH KRIHTGEKPF KCEECGKAFK QSSTLTTHKI IHTGEKPYRC EECGKAFNRS SHLTTHKIIH TGEKPYKCEE CGKAFNQSST LSTHKFIHAG EKPYKCEECD KAFNRFSYLT KHKIIHTGEK SYKCEECGKG FNWSSTLTKH KRIHTGEKPY KCEVCGKAFN ESSNLTTHKM IHTGEKPYKC EECGKAFNRS PQLTAHKIIH TGEKPYKCEE CGKAFSQSSI LTTHKRIHTG EKPYKCEECG KAFNRSSNLT KHKIIHTGEK SYKCEECGKA FNQSSTLTKH RKIHTRQKPY NCEECDNTFN QSSNLIKQNN SYWRETLQMS RMWESL. It is sometimes possible for the material contained within the vial of "Zinc finger protein 431 (ZNF431), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
