<
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Mouse anti-Human GNA14 Monoclonal Antibody | anti-GNA14 antibody
GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) (AP)
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNA14; Monoclonal Antibody; GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) (AP); anti-GNA14 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H8
Specificity
Recognizes human GNA14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GNA14 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa150-250 from GNA14 (AAH27886) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody Lane 1: GNA14 transfected lysate (41.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody Lane 1: GNA14 transfected lysate (41.6kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3ug/ml])
Testing Data
(Detection limit for recombinant GST tagged GNA14 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GNA14 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GNA14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
41,571 Da
NCBI Official Full Name
Homo sapiens guanine nucleotide binding protein (G protein), alpha 14, mRNA
NCBI Official Synonym Full Names
G protein subunit alpha 14
NCBI Official Symbol
GNA14
NCBI Protein Information
guanine nucleotide-binding protein subunit alpha-14
Protein Family
NCBI Description
This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.[provided by RefSeq, Feb 2009]
Research Articles on GNA14
Similar Products
Product Notes
The GNA14 (Catalog #AAA6131506) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNA14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNA14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNA14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
