Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Zinc finger protein 160 (ZNF160), partial Recombinant Protein | ZNF160 recombinant protein

Recombinant Human Zinc finger protein 160 (ZNF160), partial

Gene Names
ZNF160; F11; HZF5; KR18; HKr18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 160 (ZNF160); partial; Recombinant Human Zinc finger protein 160 (ZNF160); Zinc finger protein 160; Zinc finger protein HZF5; Zinc finger protein Kr18; HKr18; ZNF160 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147aa; Full Length of Isoform 2
Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for ZNF160 recombinant protein
May be involved in transcriptional regulation.
Product Categories/Family for ZNF160 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.1 kDa
NCBI Official Full Name
zinc finger protein 160
NCBI Official Synonym Full Names
zinc finger protein 160
NCBI Official Symbol
ZNF160
NCBI Official Synonym Symbols
F11; HZF5; KR18; HKr18
NCBI Protein Information
zinc finger protein 160; zinc finger protein 5; zinc finger protein HZF5; zinc finger protein Kr18; KRAB zinc finger protein KR18
UniProt Protein Name
Zinc finger protein 160
Protein Family
UniProt Gene Name
ZNF160
UniProt Synonym Gene Names
KIAA1611; HKr18
UniProt Entry Name
ZN160_HUMAN

NCBI Description

The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ZNF160: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; hemopoiesis

Research Articles on ZNF160

Similar Products

Product Notes

The ZNF160 znf160 (Catalog #AAA1357638) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147aa; Full Length of Isoform 2. The amino acid sequence is listed below: MALTQVRLTF RDVAIEFSQE EWKCLDPAQR ILYRDVMLEN YWNLVSLGLC HFDMNIISML EEGKEPWTVK SCVKIARKPR TPECVKGVVT DLLRRWKHWL LLLGICCPKP HGRVSSRLRL SRSLGHFFHS AFATFMGVCD KRVGSIF. It is sometimes possible for the material contained within the vial of "Zinc finger protein 160 (ZNF160), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.