Zinc finger protein 36, C3H1 type-like 1 (Zfp36l1) Recombinant Protein | Zfp36l1 recombinant protein

Recombinant Mouse Zinc finger protein 36, C3H1 type-like 1 (Zfp36l1)

Cat. Num. AAA950671

• Gene Names: Zfp36l1; Brf1; ERF1; cMG1; Berg36; TIS11b; AW742437; AW743212; D530020L18Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein 36; C3H1 type-like 1 (Zfp36l1); Recombinant Mouse Zinc finger protein 36; Zfp36l1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-338, Full length protein
• Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSTPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPSLSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGGRDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
• Sequence Length: 338

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Zfp36l1 recombinant protein

This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.

NCBI and Uniprot Product Information

• NCBI GI #: 6680808
• NCBI GeneID: 12192
• NCBI Accession #: NP_031590.1
• NCBI GenBank Nucleotide #: NM_007564.5
• UniProt Accession #: P23950
• Molecular Weight: 36,385 Da
• NCBI Official Full Name: mRNA decay activator protein ZFP36L1
• NCBI Official Synonym Full Names: zinc finger protein 36, C3H type-like 1
• NCBI Official Symbol: Zfp36l1
• NCBI Official Synonym Symbols: Brf1; ERF1; cMG1; Berg36; TIS11b; AW742437; AW743212; D530020L18Rik
• NCBI Protein Information: mRNA decay activator protein ZFP36L1
• UniProt Protein Name: mRNA decay activator protein ZFP36L1
• Protein Family: mRNA decay activator protein
• UniProt Gene Name: Zfp36l1
• UniProt Synonym Gene Names: ZFP36-like 1

Uniprot Description

Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:22701344, PubMed:24700863, PubMed:24733888, PubMed:27102483). Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (). Functions by recruiting the CCR4-NOT deadenylating complex and components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes (). Induces also the degradation of ARE-containing mRNAs even in absence of poly(A) tail (). Binds to 3'-UTR ARE of numerous mRNAs (PubMed:22701344, PubMed:24700863, PubMed:24733888). Positively regulates early adipogenesis by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (PubMed:22701344). Promotes ARE-mediated mRNA decay of mineralocorticoid receptor NR3C2 mRNA in response to hypertonic stress (PubMed:24700863). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (). Positively regulates monocyte/macrophage cell differentiation by promoting ARE-mediated mRNA decay of the cyclin-dependent kinase CDK6 mRNA (). Promotes degradation of ARE-containing pluripotency-associated mRNAs in embryonic stem cells (ESCs), such as NANOG, through a fibroblast growth factor (FGF)-induced MAPK-dependent signaling pathway, and hence attenuates ESC self-renewal and positively regulates mesendoderm differentiation (PubMed:24733888). May play a role in mediating pro-apoptotic effects in malignant B-cells by promoting ARE-mediated mRNA decay of BCL2 mRNA (). In association with ZFP36L2 maintains quiescence on developing B lymphocytes by promoting ARE-mediated decay of several mRNAs encoding cell cycle regulators that help B cells progress through the cell cycle, and hence ensuring accurate variable-diversity-joining (VDJ) recombination and functional immune cell formation (PubMed:27102483). Together with ZFP36L2 is also necessary for thymocyte development and prevention of T-cell acute lymphoblastic leukemia (T-ALL) transformation by promoting ARE-mediated mRNA decay of the oncogenic transcription factor NOTCH1 mRNA (PubMed:20622884). Involved in the delivery of target ARE-mRNAs to processing bodies (PBs) (). In addition to its cytosolic mRNA-decay function, plays a role in the regulation of nuclear mRNA 3'-end processing; modulates mRNA 3'-end maturation efficiency of the DLL4 mRNA through binding with an ARE embedded in a weak noncanonical polyadenylation (poly(A)) signal in endothelial cells (). Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (). Plays a role in vasculogenesis and endocardial development (PubMed:15226444, PubMed:17013884). Involved in the regulation of keratinocyte proliferation, differentiation and apoptosis (). Plays a role in myoblast cell differentiation (PubMed:17889962).