Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Palmitoyltransferase ZDHHC9 (Zdhhc9) Recombinant Protein | Zdhhc9 recombinant protein

Recombinant Mouse Palmitoyltransferase ZDHHC9 (Zdhhc9)

Gene Names
Zdhhc9; 6430508G22; 9530098M12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Palmitoyltransferase ZDHHC9 (Zdhhc9); Recombinant Mouse Palmitoyltransferase ZDHHC9 (Zdhhc9); Recombinant Palmitoyltransferase ZDHHC9 (Zdhhc9); Palmitoyltransferase ZDHHC9 EC= 2.3.1.-; Zinc finger DHHC domain-containing protein 9; DHHC-9; DHHC9; Zdhhc9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-364
Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAEDTSIPEEMPPPEPPEPPQEASEAEK
Sequence Length
364
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,940 Da
NCBI Official Full Name
palmitoyltransferase ZDHHC9
NCBI Official Synonym Full Names
zinc finger, DHHC domain containing 9
NCBI Official Symbol
Zdhhc9
NCBI Official Synonym Symbols
6430508G22; 9530098M12Rik
NCBI Protein Information
palmitoyltransferase ZDHHC9; DHHC-9; zinc finger DHHC domain-containing protein 9
UniProt Protein Name
Palmitoyltransferase ZDHHC9
Protein Family
UniProt Gene Name
Zdhhc9
UniProt Synonym Gene Names
DHHC-9; DHHC9
UniProt Entry Name
ZDHC9_MOUSE

Uniprot Description

ZDHHC9: The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. Defects in ZDHHC9 are the cause of mental retardation syndromic X-linked ZDHHC9-related (MRXSZ). A disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Some patients have marfanoid habitus as an additional feature. Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.

Protein type: EC 2.3.1.225; Membrane protein, multi-pass; Transferase; Membrane protein, integral

Cellular Component: Golgi apparatus; membrane; endoplasmic reticulum; intrinsic to Golgi membrane; cytoplasm; integral to membrane

Molecular Function: transferase activity; zinc ion binding; Ras palmitoyltransferase activity; metal ion binding; palmitoyltransferase activity; transferase activity, transferring acyl groups; protein-cysteine S-palmitoleyltransferase activity

Biological Process: peptidyl-S-palmitoyl-L-cysteine biosynthetic process from peptidyl-cysteine; protein palmitoylation

Similar Products

Product Notes

The Zdhhc9 zdhhc9 (Catalog #AAA966096) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364. The amino acid sequence is listed below: MSVMVVRKKV TRKWEKLPGR NTFCCDGRVM MARQKGIFYL TLFLILGTCT LFFAFECRYL AVQLSPAIPV FAAMLFLFSM ATLLRTSFSD PGVIPRALPD EAAFIEMEIE ATNGAVPQGQ RPPPRIKNFQ INNQIVKLKY CYTCKIFRPP RASHCSICDN CVERFDHHCP WVGNCVGKRN YRYFYLFILS LSLLTIYVFA FNIVYVALKS LKIGFLETLK ETPGTVLEVL ICFFTLWSVV GLTGFHTFLV ALNQTTNEDI KGSWTGKNRV QNPYSHGNIV KNCCEVLCGP LPPSVLDRRG ILPLEESGSR PPSTQETSSS LLPQSPASTE HMNSNEMAED TSIPEEMPPP EPPEPPQEAS EAEK. It is sometimes possible for the material contained within the vial of "Palmitoyltransferase ZDHHC9 (Zdhhc9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.