Palmitoyltransferase ZDHHC3 (Zdhhc3) Recombinant Protein | Zdhhc3 recombinant protein
Recombinant Mouse Palmitoyltransferase ZDHHC3 (Zdhhc3)
Gene Names
Zdhhc3; GODZ; DHHC-3; Gramp1; Zfp373; 1110020O22Rik; 1810006O10Rik; 2210017C02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Palmitoyltransferase ZDHHC3 (Zdhhc3); Recombinant Mouse Palmitoyltransferase ZDHHC3 (Zdhhc3); Zdhhc3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-299aa; full length protein
Sequence
MMLIPTHHFRDIERKPEYLQPEKCAPPPFPGPAGAMWFIRDGCGIACAIVTWFLVLYAEF VVLFVMLVPSRDYAYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQL KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIA LISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTSVMFGTQVH SICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Zdhhc3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,041 Da
NCBI Official Full Name
palmitoyltransferase ZDHHC3
NCBI Official Synonym Full Names
zinc finger, DHHC domain containing 3
NCBI Official Symbol
Zdhhc3
NCBI Official Synonym Symbols
GODZ; DHHC-3; Gramp1; Zfp373; 1110020O22Rik; 1810006O10Rik; 2210017C02Rik
NCBI Protein Information
palmitoyltransferase ZDHHC3
UniProt Protein Name
Palmitoyltransferase ZDHHC3
Protein Family
UniProt Gene Name
Zdhhc3
UniProt Synonym Gene Names
DHHC-3
UniProt Entry Name
ZDHC3_MOUSE
Uniprot Description
ZDHHC3: Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi. Belongs to the DHHC palmitoyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 2.3.1.225; Membrane protein, integral; Transferase; Membrane protein, multi-pass
Cellular Component: Golgi apparatus; integral to membrane; membrane
Molecular Function: metal ion binding; palmitoyltransferase activity; protein-cysteine S-palmitoleyltransferase activity; transferase activity; transferase activity, transferring acyl groups; zinc ion binding
Biological Process: protein palmitoylation; protein targeting
Research Articles on Zdhhc3
Similar Products
Product Notes
The Zdhhc3 zdhhc3 (Catalog #AAA7035703) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-299aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Zdhhc3 zdhhc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMLIPTHHFR DIERKPEYLQ PEKCAPPPFP GPAGAMWFIR DGCGIACAIV TWFLVLYAEF VVLFVMLVPS RDYAYSIING IVFNLLAFLA LASHCRAMLT DPGAVPKGNA TKEFIESLQL KPGQVVYKCP KCCSIKPDRA HHCSVCKRCI RKMDHHCPWV NNCVGENNQK YFVLFTMYIA LISLHALIMV GFHFLHCFEE DWTKCSSFSP PTTVILLILL CFEALLFLIF TSVMFGTQVH SICTDETGIE QLKKEERRWA KKTKWMNMKA VFGHPFSLGW ASPFATPDQG KADPYQYVV. It is sometimes possible for the material contained within the vial of "Palmitoyltransferase ZDHHC3 (Zdhhc3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
