Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc-activated ligand-gated ion channel (ZACN) Recombinant Protein | ZACN recombinant protein

Recombinant Human Zinc-activated ligand-gated ion channel (ZACN)

Gene Names
ZACN; L2; ZAC; ZAC1; LGICZ; LGICZ1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc-activated ligand-gated ion channel (ZACN); Recombinant Human Zinc-activated ligand-gated ion channel (ZACN); ZACN recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
26-412aa; full length protein
Sequence
GFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSML LLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVDQDGHV KLNLALATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVY DLKTQVPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYK VTLLLSYLVLHSSLVQALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGA KSGPSPAPRGEQREHGNPGPHPAEEPSRGVKGSQRSWPETADRIFFLVYVVGVLCTQFVF AGIWMWAACKSDAAPGEAAPHGRRPRL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ZACN recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,299 Da
NCBI Official Full Name
zinc-activated ligand-gated ion channel
NCBI Official Synonym Full Names
zinc activated ion channel
NCBI Official Symbol
ZACN
NCBI Official Synonym Symbols
L2; ZAC; ZAC1; LGICZ; LGICZ1
NCBI Protein Information
zinc-activated ligand-gated ion channel
UniProt Protein Name
Zinc-activated ligand-gated ion channel
UniProt Gene Name
ZACN
UniProt Synonym Gene Names
L2; LGICZ; LGICZ1; ZAC
UniProt Entry Name
ZACN_HUMAN

NCBI Description

LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM, Mar 2008]

Uniprot Description

ZACN: Zinc-activated ligand-gated ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; plasma membrane

Molecular Function: acetylcholine binding; acetylcholine receptor activity; ligand-gated ion channel activity; nicotinic acetylcholine-activated cation-selective channel activity; serotonin receptor activity; serotonin-activated cation-selective channel activity; zinc ion binding

Biological Process: response to zinc ion; serotonin receptor signaling pathway; synaptic transmission, cholinergic

Research Articles on ZACN

Similar Products

Product Notes

The ZACN zacn (Catalog #AAA7035653) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-412aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ZACN zacn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GFQGTAAIWP SLFNVNLSKK VQESIQIPNN GSAPLLVDVR VFVSNVFNVD ILRYTMSSML LLRLSWLDTR LAWNTSAHPR HAITLPWESL WTPRLTILEA LWVDWRDQSP QARVDQDGHV KLNLALATET NCNFELLHFP RDHSNCSLSF YALSNTAMEL EFQAHVVNEI VSVKREYVVY DLKTQVPPQQ LVPCFQVTLR LKNTALKSII ALLVPAEALL LADVCGGLLP LRAIERIGYK VTLLLSYLVL HSSLVQALPS SSSCNPLLIY YFTILLLLLF LSTIETVLLA GLLARGNLGA KSGPSPAPRG EQREHGNPGP HPAEEPSRGV KGSQRSWPET ADRIFFLVYV VGVLCTQFVF AGIWMWAACK SDAAPGEAAP HGRRPRL. It is sometimes possible for the material contained within the vial of "Zinc-activated ligand-gated ion channel (ZACN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.