Mitochondrial escape protein 2 (yme2) Recombinant Protein | yme2 recombinant protein
Recombinant Aspergillus niger Mitochondrial escape protein 2 (yme2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial escape protein 2 (yme2); Recombinant Aspergillus niger Mitochondrial escape protein 2 (yme2); yme2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
41-832aa; full length protein
Sequence
SHASFIETGHIDVKDDEGLVFVNNIFPSKLQWLLQGPLSGNKTYEEALKRINRPHLAASD PLHIIRRVFPQSLNVDIREVIPRFREGGAFVKYVRKDGVRDNDIVTAVQHHLEHNPIRPW FNPFQQVKVAHVHGRPWIEDLYRIPSQRLRVEFLPGSVDGAATELTTETLYSFFRRYGKL RDIERQPTDSKIAPRYAFVSFTRQKYAVMAKNCMHGFTIPEEEGGGKSGTRIKIKYERKI KFSVIKDWILNHPRIVIPAIAALIAAITVTIFDPIRTFFIEMKIKATLQTEENSVLQWIR NQANKANIIYFGRQRTDPRRLTAIWEDRQGDIKQLQSWLMENAETFIVIHGPRGTGKREL VLDRALENYKYKVVIDCKQIQDAKGDTAKIARAASQVGYRPVFSWMNSMSSFIDLAAQGM IGTKAGFSETLDAQLSKIWQNTATALKRVALSNRKKDDKEAHLSDEEYLEAHPEQRPVVV IDNFLHNATESSVVYDKITEWAAGLTTGNIAHVVFLTTDVSFSKPLSKALPNSVFRTISL GDCSLDVGRKFVLSHLEHGAKDGANSGQNMEEVGDLGTLDSCIEVLGGRVTDLEFMARRI ESGETPRAAVNRIIEQSASEILKMFVFDPDIESKQWSHEQAWHLIKTLAHSQDGTLPYNQ VLLSDLFKENGETTLRALEQAELIAISSVNGCPDAVKPGKPVYRAVFKRLTENKTLSSRL DLDIVKQLLSSENKSIGKYEQELQVLGSLPKQPRELSARIQWLLQKVASSQNKISQYEHE SAILQKVLRREH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yme2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94,310 Da
NCBI Official Full Name
escape protein 2
NCBI Official Symbol
ANI_1_2178064
NCBI Protein Information
escape protein 2
UniProt Protein Name
Mitochondrial escape protein 2
Protein Family
UniProt Gene Name
yme2
UniProt Entry Name
YME2_ASPNC
Uniprot Description
Plays a role in maintaining the mitochondrial genome and in controlling the mtDNA escape. Involved in the regulation of mtDNA nucleotide structure and number. May have a dispensable role in early maturation of pre-rRNA ().
Similar Products
Product Notes
The yme2 yme2 (Catalog #AAA7035174) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 41-832aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yme2 yme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SHASFIETGH IDVKDDEGLV FVNNIFPSKL QWLLQGPLSG NKTYEEALKR INRPHLAASD PLHIIRRVFP QSLNVDIREV IPRFREGGAF VKYVRKDGVR DNDIVTAVQH HLEHNPIRPW FNPFQQVKVA HVHGRPWIED LYRIPSQRLR VEFLPGSVDG AATELTTETL YSFFRRYGKL RDIERQPTDS KIAPRYAFVS FTRQKYAVMA KNCMHGFTIP EEEGGGKSGT RIKIKYERKI KFSVIKDWIL NHPRIVIPAI AALIAAITVT IFDPIRTFFI EMKIKATLQT EENSVLQWIR NQANKANIIY FGRQRTDPRR LTAIWEDRQG DIKQLQSWLM ENAETFIVIH GPRGTGKREL VLDRALENYK YKVVIDCKQI QDAKGDTAKI ARAASQVGYR PVFSWMNSMS SFIDLAAQGM IGTKAGFSET LDAQLSKIWQ NTATALKRVA LSNRKKDDKE AHLSDEEYLE AHPEQRPVVV IDNFLHNATE SSVVYDKITE WAAGLTTGNI AHVVFLTTDV SFSKPLSKAL PNSVFRTISL GDCSLDVGRK FVLSHLEHGA KDGANSGQNM EEVGDLGTLD SCIEVLGGRV TDLEFMARRI ESGETPRAAV NRIIEQSASE ILKMFVFDPD IESKQWSHEQ AWHLIKTLAH SQDGTLPYNQ VLLSDLFKEN GETTLRALEQ AELIAISSVN GCPDAVKPGK PVYRAVFKRL TENKTLSSRL DLDIVKQLLS SENKSIGKYE QELQVLGSLP KQPRELSARI QWLLQKVASS QNKISQYEHE SAILQKVLRR EH. It is sometimes possible for the material contained within the vial of "Mitochondrial escape protein 2 (yme2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
