Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Uncharacterized protein YhiD (yhiD) Recombinant Protein | yhiD recombinant protein

Recombinant Escherichia coli Uncharacterized protein YhiD (yhiD)

Gene Names
yhiD; ECK3492; JW5670; yhhE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein YhiD (yhiD); Recombinant Escherichia coli Uncharacterized protein YhiD (yhiD); Recombinant Uncharacterized protein YhiD (yhiD); Uncharacterized protein YhiD; yhiD recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-215
Sequence
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLDHVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGIYGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENEDHEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
Sequence Length
215
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,213 Da
NCBI Official Full Name
predicted Mg(2+) transport ATPase, inner membrane protein
NCBI Official Symbol
yhiD
NCBI Official Synonym Symbols
ECK3492; JW5670; yhhE
NCBI Protein Information
predicted Mg(2+) transport ATPase, inner membrane protein
UniProt Protein Name
Uncharacterized protein YhiD
UniProt Gene Name
yhiD
UniProt Synonym Gene Names
yhhE
UniProt Entry Name
YHID_ECOLI

NCBI Description

YhiD is a putative ATP dependent transporter of the MgtC family and may be involved in cell density-dependent acid resistance. yhiD, hdeD, or gadE mutants had reduced viability at high cell density (~108 CFU per mL) at pH 2.1 compared to wild-type . [More information is available at EcoCyc: EG11400].

Uniprot Description

Subcellular location: Cell inner membrane; Multi-pass membrane protein

Potential.

Sequence similarities: Belongs to the MgtC/SapB family.

Similar Products

Product Notes

The yhiD yhid (Catalog #AAA1224118) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-215. The amino acid sequence is listed below: MTAEFIIRLI LAAIACGAIG MERQMRGKGA GLRTHVLIGM GSALFMIVSK YGFADVLSLD HVGLDPSRIA AQVVTGVGFI GAGNILVRNQ NIVGLTTAAD IWVTAAIGMV IGSGMYELGI YGSVMTLLVL EVFHQLTFRL MNKNYHLQLT LVNGNTVSML DWFKQQKIKT DLVSLQENED HEVVAIDIQL HATTSIEDLL RLLKGMAGVK GVSIS. It is sometimes possible for the material contained within the vial of "Uncharacterized protein YhiD (yhiD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.