Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UDP-N-acetylglucosamine transporter YEA4 (YEA4) Recombinant Protein | KLLA0B03157g recombinant protein

Recombinant Kluyveromyces lactis UDP-N-acetylglucosamine transporter YEA4 (YEA4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-N-acetylglucosamine transporter YEA4 (YEA4); Recombinant Kluyveromyces lactis UDP-N-acetylglucosamine transporter YEA4 (YEA4); Recombinant UDP-N-acetylglucosamine transporter YEA4 (YEA4); UDP-N-acetylglucosamine transporter YEA4; Golgi UDP-GlcNAc transporter; KLLA0B03157g recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-328
Sequence
MSFVLILSLVFGGCCSNVISFEHMVQGSNINLGNIVTFTQFVSVTLIQLPNALDFSHFPFRLRPRHIPLKIHMLAVFLFFTSSVANNSVFKFDISVPIHIIIRCSGTTLTMIIGWAVCNKRYSKLQVQSAIIMTLGAIVASLYRDKEFSMDSLKLNTDSVGMTQKSMFGIFVVLVATALMSLLSLLNEWTYNKCGKHWKETLFYSHFLALPLFMLGYTRLRDEFRDLLISSDSMDIPIVKLPIATKLFMLIANNVTQFICIKGVNMLASNTDALTLSVVLLVRKFVSLLLSVYIYKNVLSVTAYLGTITVFLGAGLYSYGSVKTALPR
Sequence Length
328
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,667 Da
NCBI Official Full Name
hypothetical protein
NCBI Official Symbol
KLLA0B03157g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
UDP-N-acetylglucosamine transporter YEA4
UniProt Gene Name
YEA4
UniProt Synonym Gene Names
MNN2
UniProt Entry Name
YEA4_KLULA

Uniprot Description

Function: Sugar transporter that specifically mediates the transport of UDP-N-acetylglucosamine (UDP-GlcNAc) from the cytosol into Golgi vesicles where glycosyltransferases function. Ref.1

Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the nucleotide-sugar transporter family. SLC35A subfamily.

Similar Products

Product Notes

The KLLA0B03157g yea4 (Catalog #AAA1139084) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-328. The amino acid sequence is listed below: MSFVLILSLV FGGCCSNVIS FEHMVQGSNI NLGNIVTFTQ FVSVTLIQLP NALDFSHFPF RLRPRHIPLK IHMLAVFLFF TSSVANNSVF KFDISVPIHI IIRCSGTTLT MIIGWAVCNK RYSKLQVQSA IIMTLGAIVA SLYRDKEFSM DSLKLNTDSV GMTQKSMFGI FVVLVATALM SLLSLLNEWT YNKCGKHWKE TLFYSHFLAL PLFMLGYTRL RDEFRDLLIS SDSMDIPIVK LPIATKLFML IANNVTQFIC IKGVNMLASN TDALTLSVVL LVRKFVSLLL SVYIYKNVLS VTAYLGTITV FLGAGLYSYG SVKTALPR. It is sometimes possible for the material contained within the vial of "UDP-N-acetylglucosamine transporter YEA4 (YEA4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.