UPF0056 membrane protein yhcE (ychE) Recombinant Protein | ychE recombinant protein
Recombinant Escherichia coli UPF0056 membrane protein yhcE (ychE)
Gene Names
ychE; ECK1236; JW1229
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0056 membrane protein yhcE (ychE); Recombinant Escherichia coli UPF0056 membrane protein yhcE (ychE); Recombinant UPF0056 membrane protein yhcE (ychE); UPF0056 membrane protein yhcE; ychE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-215
Sequence
MIQTFFDFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALFALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGIKGIFPGLLN
Sequence Length
215
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,521 Da
NCBI Official Full Name
predicted inner membrane protein
NCBI Official Symbol
ychE
NCBI Official Synonym Symbols
ECK1236; JW1229
NCBI Protein Information
predicted inner membrane protein
UniProt Protein Name
UPF0056 membrane protein YhcE
Protein Family
UniProt Gene Name
ychE
UniProt Entry Name
YCHE_ECOLI
NCBI Description
YchE is an inner membrane protein with six predicted transmembrane domains. [More information is available at EcoCyc: EG11342].
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the UPF0056 (MarC) family.
Similar Products
Product Notes
The ychE yche (Catalog #AAA1044563) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-215. The amino acid sequence is listed below: MIQTFFDFPV YFKFFIGLFA LVNPVGIIPV FISMTSYQTA AARNKTNLTA NLSVAIILWI SLFLGDTILQ LFGISIDSFR IAGGILVVTI AMSMISGKLG EDKQNKQEKS ETAVRESIGV VPLALPLMAG PGAISSTIVW GTRYHSISYL FGFFVAIALF ALCCWGLFRM APWLVRVLRQ TGINVITRIM GLLLMALGIE FIVTGIKGIF PGLLN. It is sometimes possible for the material contained within the vial of "UPF0056 membrane protein yhcE (ychE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
