Modulator of FtsH protease YccA (yccA) Recombinant Protein | yccA recombinant protein

Recombinant Escherichia coli Modulator of FtsH protease YccA (yccA)

• Gene Names: yccA; ECK0961; JW0953
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Modulator of FtsH protease YccA (yccA); Recombinant Escherichia coli Modulator of FtsH protease YccA (yccA); Recombinant Modulator of FtsH protease YccA (yccA); Modulator of FtsH protease YccA; yccA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-219
• Sequence: MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFETSNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
• Sequence Length: 219

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 16128937
• NCBI GeneID: 946016
• NCBI Accession #: NP_415490.1
• NCBI GenBank Nucleotide #: NC_000913.2
• UniProt Accession #: P0AAC6; P06967
• Molecular Weight: 23,363 Da
• NCBI Official Full Name: HflBKC-binding inner membrane protein, UPF0005 family
• NCBI Official Symbol: yccA
• NCBI Official Synonym Symbols: ECK0961; JW0953
• NCBI Protein Information: HflBKC-binding inner membrane protein, UPF0005 family
• UniProt Protein Name: Modulator of FtsH protease YccA
• Protein Family: Modulator of FtsH protease
• UniProt Gene Name: yccA
• UniProt Entry Name: YCCA_ECOLI

NCBI Description

YccA is a substrate or modulator of FtsH-mediated proteolysis. [More information is available at EcoCyc: EG11113].

Uniprot Description

Function: Negatively modulates the activity of the FtsH protease for membrane substrates. Overexpression or stabilizing YccA counteracts the FtsH-mediated degradation of SecY when the SecYEG preprotein translocator is jammed. Ref.8

Subunit structure: Both wild-type and the yccA11 mutant interact with the FtsH/HflKC complex.

Subcellular location: Cell inner membrane; Multi-pass membrane protein. Note: There are conflicting results regarding the localization of the C-terminus of this protein; Ref.6 gives the C-terminus in the periplasm while Ref.7 gives the C-terminus in the cytoplasm. We show the periplasmic location.

Induction: Regulated in a Cpx-dependent fashion. Ref.8

Post-translational modification: YccA is processively degraded by FtsH; degradation initiates via the approximately 20 residue N-terminal tail in a sequence non-specific manner. The deletion mutant yccA11 is resistant to FtsH-mediated degradation, probably because it is too short to be degraded by FtsH.

Disruption phenotype: No effect on SecY degradation. Ref.5

Sequence similarities: Belongs to the BI1 family.