Probable L,D-transpeptidase YbiS (ybiS) Recombinant Protein | ybiS recombinant protein

Recombinant Escherichia coli Probable L,D-transpeptidase YbiS (ybiS)

Cat. Num. AAA1110425

• Gene Names: ldtB; ECK0809; JW0803; ybiS
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable L; D-transpeptidase YbiS (ybiS); Recombinant Escherichia coli Probable L; ybiS recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-306, full length protein
• Sequence: VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN
• Sequence Length: 282

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128787
• NCBI GeneID: 945441
• NCBI Accession #: NP_415340.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AAX8; P75789
• Molecular Weight: 33,325 Da
• NCBI Official Full Name: L,D-transpeptidase linking Lpp to murein
• NCBI Official Symbol: ldtB
• NCBI Official Synonym Symbols: ECK0809; JW0803; ybiS
• NCBI Protein Information: L,D-transpeptidase linking Lpp to murein
• UniProt Protein Name: Probable L,D-transpeptidase YbiS
• Protein Family: Probable L,D-transpeptidase
• UniProt Gene Name: ybiS

NCBI Description

ErfK family. [More information is available at EcoGene: EG13324]. YbiS is an L,D-transpeptidase responsible removal of the D-alanine residue of peptidoglycan tetrapeptide stems and attachment of the lysine residue of Braun lipoprotein to the meso-diaminopimelyl (DAP) residue of the resulting tripeptide. [More information is available at EcoCyc: G6422].

Uniprot Description

Responsible, at least in part, for anchoring of the major outer membrane lipoprotein (Lpp, also known as the Braun lipoprotein) to the peptidoglycan via a meso-diaminopimelyl-L-Lys- bond on the terminal residue of Lpp. Can be oxidized in vivo, its reduction depends preferentially on DsbG, although DsbC is able to partially replace DsbG.