Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Uncharacterized outer membrane usher protein ybgQ (ybgQ) Recombinant Protein | ybgQ recombinant protein

Recombinant Escherichia coli Uncharacterized outer membrane usher protein ybgQ (ybgQ)

Gene Names
ybgQ; ECK0707; JW5099
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized outer membrane usher protein ybgQ (ybgQ); Recombinant Escherichia coli Uncharacterized outer membrane usher protein ybgQ (ybgQ); ybgQ recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-815, full length protein
Sequence
VEFNLNVLDKSMRDRIDISLLKEKGVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQIDRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLFASSYRPQDGSSSTNLNAYGTAGINAGAWRLRSDYQLNKTDSEDNHDQSGGISRTYLFRPLPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVTISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQGQVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLISDDDYHSAAMGIGQNMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHSYANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAGFNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTIHRMSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAASDYSSVSSSWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSYQPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPLGADIRQDDSGISVGMVGEEGHAWLSGVAENQLFTVVWGEQSCIIHLPERLEDTTKRLILPCH
Sequence Length
794
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90,128 Da
NCBI Official Full Name
putative outer membrane protein
NCBI Official Symbol
ybgQ
NCBI Official Synonym Symbols
ECK0707; JW5099
NCBI Protein Information
putative outer membrane protein
UniProt Protein Name
Uncharacterized outer membrane usher protein YbgQ
UniProt Gene Name
ybgQ

NCBI Description

FimD family. [More information is available at EcoGene: EG13313].

Uniprot Description

Could be involved in the export and assembly of the putative YbgD fimbrial subunit across the outer membrane.

Similar Products

Product Notes

The ybgQ ybgq (Catalog #AAA1147494) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-815, full length protein. The amino acid sequence is listed below: VEFNLNVLDK SMRDRIDISL LKEKGVIAPG EYFVSVAVNN NKISNGQKIN WQKKGDKTIP CINDSLVDKF GLKPDIRQSL PQIDRCIDFS SRPEMLFNFD QANQQLNISI PQAWLAWHSE NWAPPSTWKE GVAGVLMDYN LFASSYRPQD GSSSTNLNAY GTAGINAGAW RLRSDYQLNK TDSEDNHDQS GGISRTYLFR PLPQLGSKLT LGETDFSSNI FDGFSYTGAA LASDDRMLPW ELRGYAPQIS GIAQTNATVT ISQSGRVIYQ KKVPPGPFII DDLNQSVQGT LDVKVTEEDG RVNNFQVSAA STPFLTRQGQ VRYKLAAGQP RPSMSHQTEN ETFFSNEVSW GMLSNTSLYG GLLISDDDYH SAAMGIGQNM LWLGALSFDV TWASSHFDTQ QDERGLSYRF NYSKQVDATN STISLAAYRF SDRHFHSYAN YLDHKYNDSD AQDEKQTISL SVGQPITPLN LNLYANLLHQ TWWNADASTT ANITAGFNVD IGDWRDISIS TSFNTTHYED KDRDNQIYLS ISLPFGNGGR VGYDMQNSSH STIHRMSWND TLDERNSWGM SAGLQSDRPD NGAQVSGNYQ HLSSAGEWDI SGTYAASDYS SVSSSWSGSF TATQYGAAFH RRSSTNEPRL MVSTDGVADI PVQGNLDYTN HFGIAVVPLI SSYQPSTVAV NMNDLPDGVT VAENVIKETW IEGAIGYKSL ASRSGKDVNV IIRNASGQFP PLGADIRQDD SGISVGMVGE EGHAWLSGVA ENQLFTVVWG EQSCIIHLPE RLEDTTKRLI LPCH. It is sometimes possible for the material contained within the vial of "Uncharacterized outer membrane usher protein ybgQ (ybgQ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.