Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UPF0092 membrane protein YajC (yajC) Recombinant Protein | yajC recombinant protein

Recombinant Escherichia coli UPF0092 membrane protein YajC (yajC)

Gene Names
yajC; ECK0401; JW0397
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0092 membrane protein YajC (yajC); Recombinant Escherichia coli UPF0092 membrane protein YajC (yajC); Recombinant UPF0092 membrane protein YajC (yajC); UPF0092 membrane protein YajC; yajC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-110
Sequence
MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL
Sequence Length
110
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,887 Da
NCBI Official Full Name
SecYEG protein translocase auxillary subunit
NCBI Official Symbol
yajC
NCBI Official Synonym Symbols
ECK0401; JW0397
NCBI Protein Information
SecYEG protein translocase auxillary subunit
UniProt Protein Name
UPF0092 membrane protein YajC
Protein Family
UniProt Gene Name
yajC
UniProt Entry Name
YAJC_ECOLI

NCBI Description

YajC is found in the heterotrimeric complex SecDFYajC, a heterotetrameric complex secDFYajC-YidC which can bind to SecYEG, and in an abundant ~56 kDa homoligomeric complex (Nouwen, 2002; Stenberg, 2005). [More information is available at EcoGene: EG11096]. YajC is a member of the SecD/SecF/YajC/YidC complex, which functions in concert with SecYEG to stabilize the insertion of SecA and its bound preprotein into the inner membrane. [More information is available at EcoCyc: EG11096].

Uniprot Description

Subunit structure: Part of the SecDF-YidC-YajC translocase complex; YajC is also present in a homooligomeric complex in excess of the other components. Ref.8

Subcellular location: Cell inner membrane; Single-pass membrane protein Ref.8.

Sequence similarities: Belongs to the UPF0092 family.

Research Articles on yajC

Similar Products

Product Notes

The yajC yajc (Catalog #AAA1088094) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-110. The amino acid sequence is listed below: MSFFISDAVA ATGAPAQGSP MSLILMLVVF GLIFYFMILR PQQKRTKEHK KLMDSIAKGD EVLTNGGLVG RVTKVAENGY IAIALNDTTE VVIKRDFVAA VLPKGTMKAL. It is sometimes possible for the material contained within the vial of "UPF0092 membrane protein YajC (yajC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.