Glucan 1,3-beta-glucosidase (XOG1) Recombinant Protein | XOG1 recombinant protein
Recombinant Candida albicans Glucan 1,3-beta-glucosidase (XOG1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucan 1; 3-beta-glucosidase (XOG1); Recombinant Candida albicans Glucan 1; XOG1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-438, Full length
Sequence
GGGHNVAWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Sequence Length
400
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,056 Da
NCBI Official Full Name
glucan 1,3-beta-glucosidase
NCBI Official Symbol
XOG1
NCBI Protein Information
glucan 1,3-beta-glucosidase
UniProt Protein Name
Glucan 1,3-beta-glucosidase
Protein Family
UniProt Gene Name
XOG1
UniProt Synonym Gene Names
EXG; EXG1; XOG
Uniprot Description
Major glucan 1,3-beta-glucosidase required for cell wall integrity. Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. Can also function biosynthetically as a transglycosylase. Functions to deliver glucan from the cell to the extracellular matrix. Does not appear to impact cell wall glucan content of biofilm cells, nor is it necessary for filamentation or biofilm formation. Involved in cell-substrate and cell-cell adhesion. Adhesion to host-cell surfaces is the first critical step during mucosal infection. XOG1 is target of human antimicrobial peptide LL-37 for inhibition of cell adhesion.
Similar Products
Product Notes
The XOG1 xog1 (Catalog #AAA1176084) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-438, Full length. The amino acid sequence is listed below: GGGHNVAWDY DNNVIRGVNL GGWFVLEPYM TPSLFEPFQN GNDQSGVPVD EYHWTQTLGK EAASRILQKH WSTWITEQDF KQISNLGLNF VRIPIGYWAF QLLDNDPYVQ GQVQYLEKAL GWARKNNIRV WIDLHGAPGS QNGFDNSGLR DSYNFQNGDN TQVTLNVLNT IFKKYGGNEY SDVVIGIELL NEPLGPVLNM DKLKQFFLDG YNSLRQTGSV TPVIIHDAFQ VFGYWNNFLT VAEGQWNVVV DHHHYQVFSG GELSRNINDH ISVACNWGWD AKKESHWNVA GEWSAALTDC AKWLNGVNRG ARYEGAYDNA PYIGSCQPLL DISQWSDEHK TDTRRYIEAQ LDAFEYTGGW VFWSWKTENA PEWSFQTLTY NGLFPQPVTD RQFPNQCGFH. It is sometimes possible for the material contained within the vial of "Glucan 1,3-beta-glucosidase (XOG1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
