Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Molybdate/tungstate transport system permease protein wtpB (wtpB) Recombinant Protein | PH0154 recombinant protein

Recombinant Pyrococcus horikoshii Molybdate/tungstate transport system permease protein wtpB (wtpB)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Molybdate/tungstate transport system permease protein wtpB (wtpB); Recombinant Pyrococcus horikoshii Molybdate/tungstate transport system permease protein wtpB (wtpB); Recombinant Molybdate/tungstate transport system permease protein wtpB (wtpB); Molybdate/tungstate transport system permease protein wtpB; PH0154 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-248
Sequence
MMGRDYALYFFAALGSFLVVYIVLPIVTIFAKQALDFEMLVKTVHDPLVLEALRNSLLTATATALISLFFGVPLGYILARKDFRGKNFVQAIIDVPVVIPHSVVGIMLLVTFSNAILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASRIRTFFSISLPMALPSIASGGIMAWARSMSEVGAILIVAYYPKTAQILVMEYFNNYGLRASRPISVMLMLISLSIFVFLRWLIGRVRE
Sequence Length
248
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,381 Da
NCBI Official Full Name
transport system protein
NCBI Official Symbol
PH0154
NCBI Protein Information
transport system protein
UniProt Protein Name
Molybdate/tungstate transport system permease protein WtpB
UniProt Gene Name
wtpB
UniProt Entry Name
WTPB_PYRHO

Uniprot Description

Function: Part of the ABC transporter complex WtpABC involved in molybdate/tungstate import. Probably responsible for the translocation of the substrate across the membrane

By similarity.

Subunit structure: The complex is composed of two ATP-binding proteins (WtpC), two transmembrane proteins (WtpB) and a solute-binding protein (WtpA)

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family.Contains 1 ABC transmembrane type-1 domain.

Similar Products

Product Notes

The PH0154 wtpb (Catalog #AAA1031994) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-248. The amino acid sequence is listed below: MMGRDYALYF FAALGSFLVV YIVLPIVTIF AKQALDFEML VKTVHDPLVL EALRNSLLTA TATALISLFF GVPLGYILAR KDFRGKNFVQ AIIDVPVVIP HSVVGIMLLV TFSNAILDSY KGIIAAMLFV SAPFAINSAR DGFLAVDEKL EHVARTLGAS RIRTFFSISL PMALPSIASG GIMAWARSMS EVGAILIVAY YPKTAQILVM EYFNNYGLRA SRPISVMLML ISLSIFVFLR WLIGRVRE. It is sometimes possible for the material contained within the vial of "Molybdate/tungstate transport system permease protein wtpB (wtpB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.