Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Wnt-2b (WNT2B) Recombinant Protein | WNT2B recombinant protein

Recombinant Chicken Protein Wnt-2b (WNT2B)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Wnt-2b (WNT2B); Recombinant Chicken Protein Wnt-2b (WNT2B); WNT2B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-385, Full length protein
Sequence
ECGAFPRTAGAAPRICLPFVLILLALTPRADSSWWYIGALGARVICDNIPGLVNKQRQLCQRYPDIMQSVGEGAKEWIRECQYQFRHHRWNCSTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVYAITRACSQGELKACGCDPLKRGRAKDERGEFDWGGCSDNINYGIRFAKAFVDAKEKKVKDARALMNLHNNRCGRMAVKRFLKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLQKKYNGAIQVIMNQDGTGFTVANKNFRKPTKTDLVYFENSPDYCVMDKSAGSLGTAGRVCNKVSRGTDGCEVMCCGRGYDTTRVTRVTKCECKFHWCCAVRCKECEDTVDVHTCKAPKRAEWLDQT
Sequence Length
365
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WNT2B recombinant protein
This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternatively spliced transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,953 Da
NCBI Official Full Name
protein Wnt-2b
NCBI Official Synonym Full Names
Wnt family member 2B
NCBI Official Symbol
WNT2B
NCBI Protein Information
protein Wnt-2b
UniProt Protein Name
Protein Wnt-2b
Protein Family
UniProt Gene Name
WNT2B

Uniprot Description

Ligand for members of the frizzled family of seven transmembrane receptors (PubMed:12490564). Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed:12490564). Acts as an upstream regulator of FGF10 in the lateral plate mesoderm during limb initiation in the embryo (PubMed:11290326).

Research Articles on WNT2B

Similar Products

Product Notes

The WNT2B wnt2b (Catalog #AAA1425228) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-385, Full length protein. The amino acid sequence is listed below: ECGAFPRTAG AAPRICLPFV LILLALTPRA DSSWWYIGAL GARVICDNIP GLVNKQRQLC QRYPDIMQSV GEGAKEWIRE CQYQFRHHRW NCSTLDRDHT VFGRVMLRSS REAAFVYAIS SAGVVYAITR ACSQGELKAC GCDPLKRGRA KDERGEFDWG GCSDNINYGI RFAKAFVDAK EKKVKDARAL MNLHNNRCGR MAVKRFLKLE CKCHGVSGSC TLRTCWLAMS DFRKTGDYLQ KKYNGAIQVI MNQDGTGFTV ANKNFRKPTK TDLVYFENSP DYCVMDKSAG SLGTAGRVCN KVSRGTDGCE VMCCGRGYDT TRVTRVTKCE CKFHWCCAVR CKECEDTVDV HTCKAPKRAE WLDQT. It is sometimes possible for the material contained within the vial of "Protein Wnt-2b (WNT2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.