Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein wntless (wls) Recombinant Protein | DvirGJ11298 recombinant protein

Recombinant Drosophila virilis Protein wntless (wls)

Gene Names
DvirGJ11298; dvir_GLEANR_11347; GJ11298
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein wntless (wls); Recombinant Drosophila virilis Protein wntless (wls); Recombinant Protein wntless (wls); Protein wntless; DvirGJ11298 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-562
Sequence
FLMGGLYAPVPAGHQTVVGIKCRDVPGRQNDTNFFLYSRGNGACKSLQDMDIEQDPLKMANQLVYVFQMPLPRDNRTLDYSRWQQNLIGVLQVDIAYDSSSELREPPKELQLTIDTRLAYRNKKDADTDWKLYAHSVEQRYLDCHAAHVGLLETLYTCDIIPLFELGALHHNFYLLNLRFPIDTPKRMNLQFGHMHDLTLTAIHQNGGFTQVWLLLKTLLFPFVVGIMIWFWRRVHILQRSPALLEYMLLYLGGALSFLNLPLEYLTLSIEMPYMLLLSDVRQGIFYAMLLSFWLVFAGEHMLIQDTPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMSFIVLAGVSAAIYFLFLCFMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAGLTVAGFIMGQMAEGHWKWNEDIEIQLTSAFLTGVYGMWNIYIFALIILYAPSHKQWPTMRHSDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD
Sequence Length
562
Species
Drosophila virilis (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,262 Da
NCBI Official Full Name
GJ11298
NCBI Official Symbol
DvirGJ11298
NCBI Official Synonym Symbols
dvir_GLEANR_11347; GJ11298
NCBI Protein Information
GJ11298 gene product from transcript GJ11298-RA; DvirGJ11298-PA
UniProt Protein Name
Protein wntless
UniProt Gene Name
wls
UniProt Entry Name
WLS_DROVI

Uniprot Description

Function: A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip

By similarity. UniProtKB Q95ST2

Subunit structure: Interacts with wg; in the Golgi. Interacts with Vps35, a component of the retromer complex; wls stability is regulated by Vps35

By similarity. UniProtKB Q95ST2

Subcellular location: Cell junction › synapse › presynaptic cell membrane; Multi-pass membrane protein

By similarity. Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein

By similarity. Cell membrane; Multi-pass membrane protein

By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Endosome membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Note: In non-neuronal cells, wls binds to wg in the Golgi and accompanies it to the plasma membrane where the two proteins dissociate. Wg is secreted and wls is then internalized and returns to the Golgi apparatus in a retromer-dependent manner. Wls and wg colocalize in the Golgi apparatus in wg-producing cells, and reduced expression is seen in non-producing cells. Endoplasmic recticulum expression is unchanged in wg-producing versus non-producing cells. In neuronal cells, wls is localized both pre- and postsynaptically and is transferred trans-synaptically from the pre- to the postsynaptic compartment

By similarity. UniProtKB Q95ST2

Sequence similarities: Belongs to the wntless family.

Similar Products

Product Notes

The DvirGJ11298 wls (Catalog #AAA1081480) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-562. The amino acid sequence is listed below: FLMGGLYAPV PAGHQTVVGI KCRDVPGRQN DTNFFLYSRG NGACKSLQDM DIEQDPLKMA NQLVYVFQMP LPRDNRTLDY SRWQQNLIGV LQVDIAYDSS SELREPPKEL QLTIDTRLAY RNKKDADTDW KLYAHSVEQR YLDCHAAHVG LLETLYTCDI IPLFELGALH HNFYLLNLRF PIDTPKRMNL QFGHMHDLTL TAIHQNGGFT QVWLLLKTLL FPFVVGIMIW FWRRVHILQR SPALLEYMLL YLGGALSFLN LPLEYLTLSI EMPYMLLLSD VRQGIFYAML LSFWLVFAGE HMLIQDTPNK STIRSRYWKH LSAVVVGCIS LFVFDICERG VQLRNPFYSI WTTPLGAKVA MSFIVLAGVS AAIYFLFLCF MVWKVFKDIG DKRTSLPSMS QARRLHYEGL IYRFKFLMLA TLLCAGLTVA GFIMGQMAEG HWKWNEDIEI QLTSAFLTGV YGMWNIYIFA LIILYAPSHK QWPTMRHSDE TTQSNENIVA SAASEEIEFS NLPSDSNPSE ISSLTSFTRK VAFD. It is sometimes possible for the material contained within the vial of "Protein wntless (wls), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.