Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein wntless (wls) Recombinant Protein | wls recombinant protein

Recombinant Drosophila grimshawi Protein wntless(wls)

Gene Names
DgriGH16661; dgri_GLEANR_16339; GH16661
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein wntless (wls); Recombinant Drosophila grimshawi Protein wntless(wls); wls recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
36-562aa; full length protein
Sequence
APVPAGHQTVLGSKCRDVPGRQNDTSFFLYSRGNGACKSLQDIDIEQDELKMANQLVYVF QMPLPRDNNTLQYSRWQQNLIGVLQVDIAYDSASELREPPKELQLTIDTRLAYRNQKDAD TDWKLYAHSVEQRYLDCHASHVGRLETLYTCDIIPLFELGALHHNFYLLNLRFPMDTPKQ MNLQFGHMHDLTLTAIHQNGGFTQVWLVLKTLLFPFVIGIMMWFWRRVHILQRSPALLEY MLFYLGGALSFLNLPLELLTLGVEMPYMLLLSDVRQGIFYAMLLSFWLVFAGEHMLIQDS PSKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQMRNPFYSIWTTPLGAKVAMSFIVLA GVSAAIYFLFLCFMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAGL TVAGFIMGQMAEGHWKWNENIEIQLTSAFLTGVYGMWNIYIFALIILYAPSHKQWPTMRH SDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for wls recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,187 Da
NCBI Official Full Name
GH16661
NCBI Official Symbol
DgriGH16661
NCBI Official Synonym Symbols
dgri_GLEANR_16339; GH16661
NCBI Protein Information
GH16661 gene product from transcript GH16661-RA
UniProt Protein Name
Protein wntless
Protein Family
UniProt Gene Name
wls
UniProt Entry Name
WLS_DROGR

Uniprot Description

A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip ().

Similar Products

Product Notes

The wls wls (Catalog #AAA7033604) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-562aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the wls wls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: APVPAGHQTV LGSKCRDVPG RQNDTSFFLY SRGNGACKSL QDIDIEQDEL KMANQLVYVF QMPLPRDNNT LQYSRWQQNL IGVLQVDIAY DSASELREPP KELQLTIDTR LAYRNQKDAD TDWKLYAHSV EQRYLDCHAS HVGRLETLYT CDIIPLFELG ALHHNFYLLN LRFPMDTPKQ MNLQFGHMHD LTLTAIHQNG GFTQVWLVLK TLLFPFVIGI MMWFWRRVHI LQRSPALLEY MLFYLGGALS FLNLPLELLT LGVEMPYMLL LSDVRQGIFY AMLLSFWLVF AGEHMLIQDS PSKSTIRSRY WKHLSAVVVG CISLFVFDIC ERGVQMRNPF YSIWTTPLGA KVAMSFIVLA GVSAAIYFLF LCFMVWKVFK DIGDKRTSLP SMSQARRLHY EGLIYRFKFL MLATLLCAGL TVAGFIMGQM AEGHWKWNEN IEIQLTSAFL TGVYGMWNIY IFALIILYAP SHKQWPTMRH SDETTQSNEN IVASAASEEI EFSNLPSDSN PSEISSLTSF TRKVAFD. It is sometimes possible for the material contained within the vial of "Protein wntless (wls), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.