WAP four-disulfide core domain protein 10A (WFDC10A) Recombinant Protein | WFDC10A recombinant protein
Recombinant Human WAP four-disulfide core domain protein 10A (WFDC10A)
Gene Names
WFDC10A; WAP10; C20orf146; dJ688G8.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WAP four-disulfide core domain protein 10A (WFDC10A); Recombinant Human WAP four-disulfide core domain protein 10A (WFDC10A); WFDC10A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-79, Full length protein
Sequence
GYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTYCGNVCMSIL
Sequence Length
58
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WFDC10A recombinant protein
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8,943 Da
NCBI Official Full Name
WAP four-disulfide core domain protein 10A
NCBI Official Synonym Full Names
WAP four-disulfide core domain 10A
NCBI Official Symbol
WFDC10A
NCBI Official Synonym Symbols
WAP10; C20orf146; dJ688G8.3
NCBI Protein Information
WAP four-disulfide core domain protein 10A
UniProt Protein Name
WAP four-disulfide core domain protein 10A
Protein Family
UniProt Gene Name
WFDC10A
UniProt Synonym Gene Names
C20orf146; WAP10
NCBI Description
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. [provided by RefSeq, Jul 2008]
Similar Products
Product Notes
The WFDC10A wfdc10a (Catalog #AAA1381451) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-79, Full length protein. The amino acid sequence is listed below: GYRDKKRMQK TQLSPEIKVC QQQPKLYLCK HLCESHRDCQ ANNICCSTYC GNVCMSIL. It is sometimes possible for the material contained within the vial of "WAP four-disulfide core domain protein 10A (WFDC10A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
