Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HRSP12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit RIDA Polyclonal Antibody | anti-RIDA antibody

RIDA Antibody - N-terminal region

Gene Names
RIDA; PSP; P14.5; UK114; HRSP12; hp14.5
Reactivity
Cow, Dog, Goat, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RIDA; Polyclonal Antibody; RIDA Antibody - N-terminal region; anti-RIDA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG
Sequence Length
137
Applicable Applications for anti-RIDA antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Horse: 100%; Human: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HRSP12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HRSP12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-HRSP12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-RIDA antibody
This is a rabbit polyclonal antibody against HRSP12. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-RIDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14
NCBI Official Full Name
2-iminobutanoate/2-iminopropanoate deaminase
NCBI Official Synonym Full Names
reactive intermediate imine deaminase A homolog
NCBI Official Symbol
RIDA
NCBI Official Synonym Symbols
PSP; P14.5; UK114; HRSP12; hp14.5
NCBI Protein Information
2-iminobutanoate/2-iminopropanoate deaminase
UniProt Protein Name
Ribonuclease UK114
UniProt Gene Name
HRSP12
UniProt Synonym Gene Names
PSP; p14.5
UniProt Entry Name
UK114_HUMAN

Uniprot Description

HRSP12: Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA. Belongs to the RutC family.

Protein type: Hydrolase; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 8q22

Cellular Component: mitochondrion; cytoplasm; nucleus

Molecular Function: endonuclease activity; deaminase activity

Biological Process: regulation of translational termination

Research Articles on RIDA

Similar Products

Product Notes

The RIDA hrsp12 (Catalog #AAA3210617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIDA Antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's RIDA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIDA hrsp12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSLIRRVIS TAKAPGAIGP YSQAVLVDRT IYISGQIGMD PSSGQLVSGG. It is sometimes possible for the material contained within the vial of "RIDA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.