Probable AP endonuclease (War-144) Recombinant Protein | War-144 recombinant protein
Recombinant African swine fever virus Probable AP endonuclease (War-144)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable AP endonuclease (War-144); Recombinant African swine fever virus Probable AP endonuclease (War-144); War-144 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296, Full length protein
Sequence
MFGAFVSHRLWSDSGCTTTCITNSIANYVAFGEQIGFPFKSAQVFIAGPRKAVINIQEDDKVELLKMIVKHNLWVVAHGTYLDVPWSRRSAFVTHFIQQELLICKEVGIKGLVLHLGAVEPELIVEGLKKIKPVEGVVIYLETPHNKHHTYKYSTMEQIKELFLRIRNTRLKQIGLCIDTAHIWSSGVNISSYNDAGQWLRSLENIHSVIPPSHIMFHLNDAATECGSGIDRHASLFEGMIWKSYSHKIKKSGLYCFVEYITRHQCPAILERNLGSSMQLQTALTAEFTTLKSLLK
Sequence Length
296
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
Uniprot Description
Endonuclease that plays a role in DNA repair. Cleaves phosphodiester bonds on the 5' side of apurinic or apyrimidinic sites (AP sites). In addition to endonuclease activity, the ASFV enzyme has a proofreading 3'-5' exonuclease activity that is considerably more efficient in the elimination of a mismatch than in that of a correctly paired base. Displays 3'-phosphatase and 3'-repair diesterase activities. The single nucleotide gaps generated by the AP endonuclease are filled by the viral AP endonuclease and DNA ligase ().
Similar Products
Product Notes
The War-144 war-144 (Catalog #AAA1043938) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296, Full length protein. The amino acid sequence is listed below: MFGAFVSHRL WSDSGCTTTC ITNSIANYVA FGEQIGFPFK SAQVFIAGPR KAVINIQEDD KVELLKMIVK HNLWVVAHGT YLDVPWSRRS AFVTHFIQQE LLICKEVGIK GLVLHLGAVE PELIVEGLKK IKPVEGVVIY LETPHNKHHT YKYSTMEQIK ELFLRIRNTR LKQIGLCIDT AHIWSSGVNI SSYNDAGQWL RSLENIHSVI PPSHIMFHLN DAATECGSGI DRHASLFEGM IWKSYSHKIK KSGLYCFVEY ITRHQCPAIL ERNLGSSMQL QTALTAEFTT LKSLLK. It is sometimes possible for the material contained within the vial of "Probable AP endonuclease (War-144), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
