Visual system homeobox 2 (VSX2) Recombinant Protein | VSX2 recombinant protein
Recombinant Human Visual system homeobox 2 (VSX2)
Gene Names
VSX2; RET1; CHX10; HOX10; MCOP2; MCOPCB3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Visual system homeobox 2 (VSX2); Recombinant Human Visual system homeobox 2 (VSX2); VSX2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-361, Full length protein
Sequence
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Sequence Length
361
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for VSX2 recombinant protein
This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,411 Da
NCBI Official Full Name
visual system homeobox 2
NCBI Official Synonym Full Names
visual system homeobox 2
NCBI Official Symbol
VSX2
NCBI Official Synonym Symbols
RET1; CHX10; HOX10; MCOP2; MCOPCB3
NCBI Protein Information
visual system homeobox 2
UniProt Protein Name
Visual system homeobox 2
Protein Family
UniProt Gene Name
VSX2
UniProt Synonym Gene Names
CHX10; HOX10
NCBI Description
This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009]
Uniprot Description
Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells ().
Research Articles on VSX2
Similar Products
Product Notes
The VSX2 vsx2 (Catalog #AAA959073) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361, Full length protein. The amino acid sequence is listed below: MTGKAGEALS KPKSETVAKS TSGGAPARCT GFGIQEILGL NKEPPSSHPR AALDGLAPGH LLAARSVLSP AGVGGMGLLG PGGLPGFYTQ PTFLEVLSDP QSVHLQPLGR ASGPLDTSQT ASSDSEDVSS SDRKMSKSAL NQTKKRKKRR HRTIFTSYQL EELEKAFNEA HYPDVYAREM LAMKTELPED RIQVWFQNRR AKWRKREKCW GRSSVMAEYG LYGAMVRHSI PLPESILKSA KDGIMDSCAP WLLGMHKKSL EAAAESGRKP EGERQALPKL DKMEQDERGP DAQAAISQEE LRENSIAVLR AKAQEHSTKV LGTVSGPDSL ARSTEKPEEE EAMDEDRPAE RLSPPQLEDM A. It is sometimes possible for the material contained within the vial of "Visual system homeobox 2 (VSX2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
