SDS-Page
Vesicular, overexpressed in cancer, prosurvival protein 1 Recombinant Protein | VOPP1 recombinant protein
Recombinant Human Vesicular, overexpressed in cancer, prosurvival protein 1
Gene Names
VOPP1; ECOP; GASP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vesicular; overexpressed in cancer; prosurvival protein 1; Recombinant Human Vesicular; EGFR-coamplified and overexpressed protein; ECopGlioblastoma-amplified secreted protein; Putative NF-kappa-B-activating protein 055N; VOPP1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-172
Sequence
KKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK
Sequence Length
155
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for VOPP1 recombinant protein
Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.
Product Categories/Family for VOPP1 recombinant protein
References
Towards a catalog of human genes and proteins
sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B., Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44.2kD
NCBI Official Full Name
vesicular, overexpressed in cancer, prosurvival protein 1 isoform 2
NCBI Official Synonym Full Names
vesicular, overexpressed in cancer, prosurvival protein 1
NCBI Official Symbol
VOPP1
NCBI Official Synonym Symbols
ECOP; GASP
NCBI Protein Information
vesicular, overexpressed in cancer, prosurvival protein 1
UniProt Protein Name
Vesicular, overexpressed in cancer, prosurvival protein 1
Protein Family
UniProt Gene Name
VOPP1
UniProt Synonym Gene Names
ECOP; GASP; ECop
UniProt Entry Name
VOPP1_HUMAN
Uniprot Description
ECOP: Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed. Belongs to the VOPP1/ECOP family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 7p11.2
Cellular Component: cytoplasmic vesicle membrane; endosome
Molecular Function: signal transducer activity
Biological Process: regulation of transcription, DNA-dependent; signal transduction; transcription, DNA-dependent
Research Articles on VOPP1
Similar Products
Product Notes
The VOPP1 vopp1 (Catalog #AAA717095) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-172. The amino acid sequence is listed below: KKHCWYFEGL YPTYYICRSY EDCCGSRCCV RALSIQRLWY FWFLLMMGVL FCCGAGFFIR RRMYPPPLIE EPAFNVSYTR QPPNPGPGAQ QPGPPYYTDP GGPGMNPVGN SMAMAFQVPP NSPQGSVACP PPPAYCNTPP PPYEQVVKAK. It is sometimes possible for the material contained within the vial of "Vesicular, overexpressed in cancer, prosurvival protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
