Selenoprotein S (Sels) Recombinant Protein | Sels recombinant protein

Recombinant Mouse Selenoprotein S (Sels)

Cat. Num. AAA7029592

• Gene Names: Vimp; H4; H-4; H47; H-47; Sels; C78786; 1500011E07Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Selenoprotein S (Sels); Recombinant Mouse Selenoprotein S (Sels); Sels recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-190aa; full length protein
• Sequence: MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQ RQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUN
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Sels recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 111119010
• NCBI GeneID: 109815
• NCBI Accession #: NP_077759.3
• NCBI GenBank Nucleotide #: NM_024439.3
• UniProt Accession #: Q9BCZ4; Q921S1; Q9DB55
• Molecular Weight: 21,509 Da
• NCBI Official Full Name: selenoprotein S
• NCBI Official Synonym Full Names: VCP-interacting membrane protein
• NCBI Official Symbol: Vimp
• NCBI Official Synonym Symbols: H4; H-4; H47; H-47; Sels; C78786; 1500011E07Rik
• NCBI Protein Information: selenoprotein S
• UniProt Protein Name: Selenoprotein S
• Protein Family: Selenoprotein
• UniProt Gene Name: Vimp
• UniProt Synonym Gene Names: H47; Sels; SelS
• UniProt Entry Name: SELS_MOUSE

NCBI Description

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]

Uniprot Description

SELS: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination. Belongs to the selenoprotein S family.

Protein type: Endoplasmic reticulum; Membrane protein, integral

Cellular Component: cytoplasm; cytoplasmic microtubule; endoplasmic reticulum; integral to endoplasmic reticulum membrane; integral to membrane; membrane

Molecular Function: antioxidant activity; ATPase binding; enzyme binding; protein binding

Biological Process: cell redox homeostasis; ER overload response; ER-associated protein catabolic process; intracellular protein transport; negative regulation of acute inflammatory response to antigenic stimulus; negative regulation of inflammatory response; negative regulation of interleukin-6 production; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of tumor necrosis factor production; response to redox state; retrograde protein transport, ER to cytosol; unfolded protein response