Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Head virion protein G6P (VI) Recombinant Protein | VI recombinant protein

Recombinant Xanthomonas phage phiLf Head virion protein G6P (VI)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Head virion protein G6P (VI); Recombinant Xanthomonas phage phiLf Head virion protein G6P (VI); Recombinant Head virion protein G6P (VI); Head virion protein G6P; Coat protein D G6P; VI recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-95
Sequence
MAVACGQDGVAGDCRFLGDLFVMWLEQSLSAILYVLTLLPMPDFMKGQSIGGMLGNAGSTILWFADVFMIGPALVMIGAAMIFFLLRRVLTLGIW
Sequence Length
95
Species
Xanthomonas phage phiLf (Bacteriophage phi-Lf)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
10,276 Da
NCBI Official Full Name
Head virion protein G6P
UniProt Protein Name
Head virion protein G6P
Protein Family
UniProt Gene Name
VI
UniProt Entry Name
G6P_BPPHL

Uniprot Description

Function: Plays essential roles both in the entry of the viral genome into the bacterial host and in budding process. The formation of the G3P-G6P complex termed adsorption complex is essential for correct termination of filamentous phage assembly.

Subunit structure: Interacts with G3P; this interaction is required for proper integration of G3P and G6P into the virion

By similarity.

Subcellular location: Virion

Potential. Host membrane; Multi-pass membrane protein

Potential. Note: Prior to assembly, G6P is found associated with the bacterial host inner membrane. There are about five copies of G6P in the mature virion. They are located together with G3P at the head side of the filamentous virion

By similarity.

Sequence similarities: Belongs to the inovirus G6P protein family.

Similar Products

Product Notes

The Head virion protein G6P (VI) vi (Catalog #AAA1163919) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-95. The amino acid sequence is listed below: MAVACGQDGV AGDCRFLGDL FVMWLEQSLS AILYVLTLLP MPDFMKGQSI GGMLGNAGST ILWFADVFMI GPALVMIGAA MIFFLLRRVL TLGIW. It is sometimes possible for the material contained within the vial of "Head virion protein G6P (VI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.