Vascular endothelial growth factor C Recombinant Protein | Vegfc recombinant protein

Recombinant Mouse Vascular endothelial growth factor C

Cat. Num. AAA965722

• Gene Names: Vegfc; VEGF-C; AW228853
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vascular endothelial growth factor C; Recombinant Mouse Vascular endothelial growth factor C; Flt4 ligand; Flt4-L; Vascular endothelial growth factor-related protein; VRP; Vegfc recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 108-223aa; Full Length
• Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Sequence Length: 223

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Vegfc recombinant protein

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

References

VEGF-C receptor binding and pattern of expression with VEGFR-3 suggests a role in lymphatic vascular development.Kukk E., Lymboussaki A., Taira S., Kaipainen A., Jeltsch M., Joukov V., Alitalo K.Development 122:3829-3837(1996) Characterization of murine Flt4 ligand/VEGF-C.Fitz L.J., Morris J.C., Towler P., Long A., Burgess P., Greco R., Wang J., Gassaway R., Nickbarg E., Kovacic S., Ciarletta A., Giannotti J., Finnerty H., Zollner R., Beier D.R., Leak L.V., Turner K.J., Wood C.R.Oncogene 15:613-618(1997) Characterization of novel VEGF (vascular endothelial growth factor) -C splicing isoforms from mouse.Wang Z.G., Puri T.S., Quigg R.J.Biochem. J. 428:347-354(2010) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.

NCBI and Uniprot Product Information

• NCBI GI #: 6678565
• NCBI GeneID: 22341
• NCBI Accession #: NP_033532.1
• NCBI GenBank Nucleotide #: NM_009506.2
• UniProt Accession #: P97953; Q543R6; C6F5S8; C6F5S9; C6F5T0
• Molecular Weight: 15 kDa
• NCBI Official Full Name: vascular endothelial growth factor C
• NCBI Official Synonym Full Names: vascular endothelial growth factor C
• NCBI Official Symbol: Vegfc
• NCBI Official Synonym Symbols: VEGF-C; AW228853
• NCBI Protein Information: vascular endothelial growth factor C
• UniProt Protein Name: Vascular endothelial growth factor C
• Protein Family: Vascular endothelial growth factor
• UniProt Gene Name: Vegfc
• UniProt Synonym Gene Names: VEGF-C; Flt4-L; VRP
• UniProt Entry Name: VEGFC_MOUSE

Uniprot Description

VEGFC: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Homodimer; non-covalent and antiparallel. Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte. Belongs to the PDGF/VEGF growth factor family.

Protein type: Secreted; Motility/polarity/chemotaxis; Cytokine; Cell cycle regulation; Secreted, signal peptide

Cellular Component: extracellular region; extracellular space; membrane

Molecular Function: chemoattractant activity; growth factor activity; protein binding; vascular endothelial growth factor receptor 3 binding

Biological Process: angiogenesis; cell differentiation; induction of positive chemotaxis; morphogenesis of embryonic epithelium; multicellular organismal development; negative regulation of blood pressure; negative regulation of cell proliferation; organ morphogenesis; positive chemotaxis; positive regulation of angiogenesis; positive regulation of blood vessel endothelial cell migration; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of cell-matrix adhesion; positive regulation of epithelial cell proliferation; positive regulation of neuroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of protein amino acid autophosphorylation; positive regulation of protein secretion; regulation of vascular endothelial growth factor receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway