Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Versican core protein (VCAN) Recombinant Protein | VCAN recombinant protein

Recombinant Bovine Versican core protein (VCAN) , partial

Gene Names
VCAN; CSPG2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Versican core protein (VCAN); Recombinant Bovine Versican core protein (VCAN); partial; VCAN recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-147. Ig-like V-type domain
Sequence
LQKVNMEKSPPVKGSLSGKVNLPCHFSTMPTLPPSYNTTSEFLRIKWSKIELDKTGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEDVGDASLTMVKLLASDAGRYRCDVMYGIEDTQDTVSLT
Sequence Length
147
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for VCAN recombinant protein
This gene is a member of the aggrecan
versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,793 Da
NCBI Official Full Name
versican core protein
NCBI Official Synonym Full Names
versican
NCBI Official Symbol
VCAN
NCBI Official Synonym Symbols
CSPG2
NCBI Protein Information
versican core protein
UniProt Protein Name
Versican core protein
Protein Family
UniProt Gene Name
VCAN
UniProt Synonym Gene Names
CSPG2; Chondroitin sulfate proteoglycan 2; GHAP

Uniprot Description

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Research Articles on VCAN

Similar Products

Product Notes

The VCAN vcan (Catalog #AAA964648) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-147. Ig-like V-type domain. The amino acid sequence is listed below: LQKVNMEKSP PVKGSLSGKV NLPCHFSTMP TLPPSYNTTS EFLRIKWSKI ELDKTGKDLK ETTVLVAQNG NIKIGQDYKG RVSVPTHPED VGDASLTMVK LLASDAGRYR CDVMYGIEDT QDTVSLT . It is sometimes possible for the material contained within the vial of "Versican core protein (VCAN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.