Versican core protein (Vcan) Recombinant Protein | Vcan recombinant protein
Recombinant Mouse Versican core protein (Vcan) , partial
Gene Names
Vcan; NG2; hdf; PG-M; Cspg2; DPEAAE; PG-M(V0); PG-M(V1); 9430051N09; 5430420N07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Versican core protein (Vcan); Recombinant Mouse Versican core protein (Vcan); partial; Vcan recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-146aa; Partial
Sequence
AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Sequence Length
146
Species
Mouse
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Vcan recombinant protein
This gene is a member of the aggrecan
versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene.
versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
20.9 kDa
NCBI Official Full Name
Versican core protein
NCBI Official Synonym Full Names
versican
NCBI Official Symbol
Vcan
NCBI Official Synonym Symbols
NG2; hdf; PG-M; Cspg2; DPEAAE; PG-M(V0); PG-M(V1); 9430051N09; 5430420N07Rik
NCBI Protein Information
versican core protein
UniProt Protein Name
Versican core protein
Protein Family
UniProt Gene Name
Vcan
UniProt Synonym Gene Names
Cspg2; Chondroitin sulfate proteoglycan 2
Uniprot Description
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Research Articles on Vcan
Similar Products
Product Notes
The Vcan vcan (Catalog #AAA1448392) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-146aa; Partial. The amino acid sequence is listed below: AKMETSPPVK GSLSGKVVLP CHFSTLPTLP PNYNTSEFLR IKWSKMEVDK NGKDIKETTV LVAQNGNIKI GQDYKGRVSV PTHPDDVGDA SLTMVKLRAS DAAVYRCDVM YGIEDTQDTM SLA. It is sometimes possible for the material contained within the vial of "Versican core protein (Vcan), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
