Probable ribonuclease VapC20 (vapC20) Recombinant Protein | vapC20 recombinant protein
Recombinant Mycobacterium tuberculosis Probable ribonuclease VapC20 (vapC20)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ribonuclease VapC20 (vapC20); Recombinant Mycobacterium tuberculosis Probable ribonuclease VapC20 (vapC20); vapC20 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-131, Full length protein
Sequence
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Sequence Length
131
Species
Mycobacterium tuberculosis
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,620 Da
NCBI Official Full Name
ribonuclease VapC20
NCBI Official Symbol
vapC20
NCBI Protein Information
ribonuclease VapC20
UniProt Protein Name
23S rRNA-specific endonuclease VapC20
Protein Family
UniProt Gene Name
vapC20
UniProt Synonym Gene Names
RNase VapC20
Uniprot Description
Toxic component of a type II toxin-antitoxin (TA) system (PubMed:19016878, PubMed:24225902). An endoribonuclease that cleaves both E.coli and M.smegmatis 23S rRNA between G2661 and A2662 in the sarcin-ricin loop (SRL, E.coli 23S rRNA numbering). The SRL sequence is highly conserved and is implicated in GTP hydrolysis by EF-Tu and EF-G. Acts on purified ribosomes but not on isolated RNA in E.coli, nor on a shortened artificial substrate (PubMed:24225902). Upon expression in E.coli inhibits cell growth, colony formation and translation. Its toxic effect is neutralized by coexpression, or subsequent expression (tested over 2 hours) with cognate antitoxin VapB20 (PubMed:19016878, PubMed:24225902).
Research Articles on vapC20
Similar Products
Product Notes
The vapC20 vapc20 (Catalog #AAA1009439) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-131, Full length protein. The amino acid sequence is listed below: MIFVDTSFWA ALGNAGDARH GTAKRLWASK PPVVMTSNHV LGETWTLLNR RCGHRAAVAA AAIRLSTVVR VEHVTADLEE QAWEWLVRHD EREYSFVDAT SFAVMRKKGI QNAYAFDGDF SAAGFVEVRP E. It is sometimes possible for the material contained within the vial of "Probable ribonuclease VapC20 (vapC20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
