Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Vesicle-associated membrane protein 2 Recombinant Protein | VAMP2 recombinant protein

Recombinant Human Vesicle-associated membrane protein 2

Gene Names
VAMP2; SYB2; VAMP-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vesicle-associated membrane protein 2; Recombinant Human Vesicle-associated membrane protein 2; Synaptobrevin-2; VAMP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-116aa; Full Length
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Sequence Length
116
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for VAMP2 recombinant protein
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Product Categories/Family for VAMP2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.7 kDa
NCBI Official Full Name
vesicle-associated membrane protein 2
NCBI Official Synonym Full Names
vesicle associated membrane protein 2
NCBI Official Symbol
VAMP2
NCBI Official Synonym Symbols
SYB2; VAMP-2
NCBI Protein Information
vesicle-associated membrane protein 2
UniProt Protein Name
Vesicle-associated membrane protein 2
UniProt Gene Name
VAMP2
UniProt Synonym Gene Names
SYB2; VAMP-2
UniProt Entry Name
VAMP2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. [provided by RefSeq, Jul 2008]

Uniprot Description

VAMP2: a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. Thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Vesicle

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: cell junction; clathrin-coated vesicle; cytoplasmic vesicle; cytosol; integral to plasma membrane; intracellular membrane-bound organelle; membrane; neuron projection; perinuclear region of cytoplasm; plasma membrane; secretory granule; secretory granule membrane; SNARE complex; synapse; synaptic vesicle; synaptic vesicle membrane; terminal button; trans-Golgi network; vesicle; voltage-gated potassium channel complex; zymogen granule membrane

Molecular Function: calcium-dependent protein binding; calmodulin binding; identical protein binding; myosin binding; phospholipid binding; protein binding; protein C-terminus binding; protein complex binding; protein self-association; SNAP receptor activity; SNARE binding; syntaxin binding; syntaxin-1 binding

Biological Process: calcium ion-dependent exocytosis; cellular protein metabolic process; cellular response to insulin stimulus; energy reserve metabolic process; eosinophil degranulation; exocytosis; glutamate secretion; Golgi to plasma membrane protein transport; natural killer cell degranulation; neurotransmitter secretion; neutrophil degranulation; post-Golgi vesicle-mediated transport; protein complex assembly; protein transport; regulation of exocytosis; regulation of insulin secretion; response to glucose stimulus; synaptic transmission; synaptic vesicle exocytosis; vesicle fusion; vesicle-mediated transport

Research Articles on VAMP2

Similar Products

Product Notes

The VAMP2 vamp2 (Catalog #AAA1123065) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-116aa; Full Length. The amino acid sequence is listed below: MSATAATAPP AAPAGEGGPP APPPNLTSNR RLQQTQAQVD EVVDIMRVNV DKVLERDQKL SELDDRADAL QAGASQFETS AAKLKRKYWW KNLKMMIILG VICAIILIII IVYFST. It is sometimes possible for the material contained within the vial of "Vesicle-associated membrane protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.