U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A) Recombinant Protein | UTP14A recombinant protein
Recombinant Bovine U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A) , partial
Gene Names
UTP14A; UTP14C
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A); Recombinant Bovine U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A); partial; UTP14A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence
MNANQAAESNLLASNQQKELEDLPKDYPLSTSEDEGDKDEERKHQKLLESISSLNGKDRQKLADRSEASLKVSEFSVSSEGSGEKLVLSDLLEPVKTSSSLAAVKKQLNRVKSKKTVELPLHREEIERIHREVAFNKSSQILSKWDPVVLKNRQAEQLVFPLSKPQSAFAPIEHVVNGWKAGTPLEQEIFNLLHKNKQPVTDPLLTPVEKASLKAMSLEEVKMRRAELQRARALQSYYEARARREKRIKSKKYHRILKKGKAKQALKDFEKLQKVNPAAALEELEKLDKARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLARNKELTQKVRAASESEEEGEG
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for UTP14A recombinant protein
This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,087 Da
NCBI Official Full Name
U3 small nucleolar RNA-associated protein 14 homolog A
NCBI Official Symbol
UTP14A
NCBI Official Synonym Symbols
UTP14C
NCBI Protein Information
U3 small nucleolar RNA-associated protein 14 homolog A
UniProt Protein Name
U3 small nucleolar RNA-associated protein 14 homolog A
Protein Family
UniProt Gene Name
UTP14A
Uniprot Description
May be required for ribosome biogenesis.
Similar Products
Product Notes
The UTP14A utp14a (Catalog #AAA1462367) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MNANQAAESN LLASNQQKEL EDLPKDYPLS TSEDEGDKDE ERKHQKLLES ISSLNGKDRQ KLADRSEASL KVSEFSVSSE GSGEKLVLSD LLEPVKTSSS LAAVKKQLNR VKSKKTVELP LHREEIERIH REVAFNKSSQ ILSKWDPVVL KNRQAEQLVF PLSKPQSAFA PIEHVVNGWK AGTPLEQEIF NLLHKNKQPV TDPLLTPVEK ASLKAMSLEE VKMRRAELQR ARALQSYYEA RARREKRIKS KKYHRILKKG KAKQALKDFE KLQKVNPAAA LEELEKLDKA RMMERMSLKH QNSGKWAKSK AIMAKYDLEA RQAMQEQLAR NKELTQKVRA ASESEEEGEG . It is sometimes possible for the material contained within the vial of "U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
