Western Blot (WB)
(WB Suggested Anti-UTP14A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit UTP14A Polyclonal Antibody | anti-UTP14A antibody
UTP14A antibody - N-terminal region
Gene Names
UTP14A; Utp14; NYCO16; SDCCAG16; dJ537K23.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UTP14A; Polyclonal Antibody; UTP14A antibody - N-terminal region; anti-UTP14A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
Sequence Length
771
Applicable Applications for anti-UTP14A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UTP14A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UTP14A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-UTP14A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-UTP14A antibody
This is a rabbit polyclonal antibody against UTP14A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-UTP14A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88
NCBI Official Full Name
U3 small nucleolar RNA-associated protein 14 homolog A isoform 1
NCBI Official Synonym Full Names
UTP14A small subunit processome component
NCBI Official Symbol
UTP14A
NCBI Official Synonym Symbols
Utp14; NYCO16; SDCCAG16; dJ537K23.3
NCBI Protein Information
U3 small nucleolar RNA-associated protein 14 homolog A
UniProt Protein Name
U3 small nucleolar RNA-associated protein 14 homolog A
Protein Family
UniProt Gene Name
UTP14A
UniProt Synonym Gene Names
SDCCAG16
UniProt Entry Name
UT14A_HUMAN
NCBI Description
This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
Uniprot Description
UTP14A: May be required for ribosome biogenesis. Belongs to the UTP14 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA processing; RNA-binding; Nucleolus
Chromosomal Location of Human Ortholog: Xq26.1
Cellular Component: small subunit processome; nucleolus
Molecular Function: protein binding
Biological Process: maturation of SSU-rRNA
Research Articles on UTP14A
Similar Products
Product Notes
The UTP14A utp14a (Catalog #AAA3210675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UTP14A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UTP14A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UTP14A utp14a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KWDPVVLKNR QAEQLVFPLE KEEPAIAPIE HVLSGWKART PLEQEIFNLL. It is sometimes possible for the material contained within the vial of "UTP14A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
