Cytochrome b-c1 complex subunit 2, mitochondrial (UQCRC2) Recombinant Protein | UQCRC2 recombinant protein
Recombinant Human Cytochrome b-c1 complex subunit 2, mitochondrial (UQCRC2)
Gene Names
UQCRC2; QCR2; UQCR2; MC3DN5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-c1 complex subunit 2; mitochondrial (UQCRC2); Recombinant Human Cytochrome b-c1 complex subunit 2; UQCRC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
15-453, Full length protein
Sequence
SLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Sequence Length
439
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,443 Da
NCBI Official Full Name
cytochrome b-c1 complex subunit 2, mitochondrial
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase core protein 2
NCBI Official Symbol
UQCRC2
NCBI Official Synonym Symbols
QCR2; UQCR2; MC3DN5
NCBI Protein Information
cytochrome b-c1 complex subunit 2, mitochondrial
UniProt Protein Name
Cytochrome b-c1 complex subunit 2, mitochondrial
UniProt Gene Name
UQCRC2
NCBI Description
The protein encoded by this gene is located in the mitochondrion, where it is part of the ubiquinol-cytochrome c reductase complex (also known as complex III). This complex constitutes a part of the mitochondrial respiratory chain. Defects in this gene are a cause of mitochondrial complex III deficiency nuclear type 5. [provided by RefSeq, Jul 2015]
Uniprot Description
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
Research Articles on UQCRC2
Similar Products
Product Notes
The UQCRC2 uqcrc2 (Catalog #AAA962334) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 15-453, Full length protein. The amino acid sequence is listed below: SLKVAPKVKA TAAPAGAPPQ PQDLEFTKLP NGLVIASLEN YSPVSRIGLF IKAGSRYEDF SNLGTTHLLR LTSSLTTKGA SSFKITRGIE AVGGKLSVTA TRENMAYTVE CLRGDVDILM EFLLNVTTAP EFRRWEVADL QPQLKIDKAV AFQNPQTHVI ENLHAAAYRN ALANPLYCPD YRIGKVTSEE LHYFVQNHFT SARMALIGLG VSHPVLKQVA EQFLNMRGGL GLSGAKANYR GGEIREQNGD SLVHAAFVAE SAVAGSAEAN AFSVLQHVLG AGPHVKRGSN TTSHLHQAVA KATQQPFDVS AFNASYSDSG LFGIYTISQA TAAGDVIKAA YNQVKTIAQG NLSNTDVQAA KNKLKAGYLM SVESSECFLE EVGSQALVAG SYMPPSTVLQ QIDSVANADI INAAKKFVSG QKSMAASGNL GHTPFVDEL. It is sometimes possible for the material contained within the vial of "Cytochrome b-c1 complex subunit 2, mitochondrial (UQCRC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
