Cytochrome b-c1 complex subunit 10 Recombinant Protein | UQCR/UQCR11 recombinant protein

Recombinant Human Cytochrome b-c1 complex subunit 10 protein

Cat. Num. AAA717090

• Gene Names: UQCR11; UQCR; QCR10; 0710008D09Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cytochrome b-c1 complex subunit 10; Recombinant Human Cytochrome b-c1 complex subunit 10 protein; Complex III subunit 10; Complex III subunit XI; Ubiquinol-cytochrome c reductase complex 6.4 kDa protein; UQCR/UQCR11 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-56aa; Full Length
• Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
• Sequence Length: 56

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for UQCR/UQCR11 recombinant protein

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.

Product Categories/Family for UQCR/UQCR11 recombinant protein

Transport

References

Primary structure of the smallest (6.4-kDa) subunit of human and bovine ubiquinol-cytochrome c reductase deduced from cDNA sequences.Islam M.M., Suzuki H., Yoneda M., Tanaka M.Biochem. Mol. Biol. Int. 41:1109-1116(1997) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 5803217
• NCBI GeneID: 10975
• NCBI Accession #: NP_006821.1
• NCBI GenBank Nucleotide #: NM_006830.3
• UniProt Accession #: O14957; Q9UEA3; Q9UPK4; B2R542; D6W5Z4
• Molecular Weight: 33.6 kDa
• NCBI Official Full Name: cytochrome b-c1 complex subunit 10
• NCBI Official Synonym Full Names: ubiquinol-cytochrome c reductase, complex III subunit XI
• NCBI Official Symbol: UQCR11
• NCBI Official Synonym Symbols: UQCR; QCR10; 0710008D09Rik
• NCBI Protein Information: cytochrome b-c1 complex subunit 10
• UniProt Protein Name: Cytochrome b-c1 complex subunit 10
• Protein Family: Cytochrome b-c1 complex
• UniProt Gene Name: UQCR11
• UniProt Synonym Gene Names: UQCR
• UniProt Entry Name: QCR10_HUMAN

NCBI Description

This gene encodes the smallest known component of the ubiquinol-cytochrome c reductase complex, which forms part of the mitochondrial respiratory chain. The encoded protein may function as a binding factor for the iron-sulfur protein in this complex. [provided by RefSeq, Oct 2009]

Uniprot Description

UQCR: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. Belongs to the UQCR11/QCR10 family.

Protein type: Membrane protein, integral; Mitochondrial; Energy Metabolism - oxidative phosphorylation; EC 1.10.2.2; Oxidoreductase

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: integral to membrane; mitochondrial inner membrane

Molecular Function: electron carrier activity; ubiquinol-cytochrome-c reductase activity

Biological Process: cellular metabolic process; generation of precursor metabolites and energy