Undecaprenyl-diphosphatase (uppP) Recombinant Protein | JJD26997_0215 recombinant protein
Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Undecaprenyl-diphosphatase (uppP); Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP); Recombinant Undecaprenyl-diphosphatase (uppP); Undecaprenyl-diphosphatase EC= 3.6.1.27; Bacitracin resistance protein Undecaprenyl pyrophosphate phosphatase; JJD26997_0215 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-267
Sequence
MGNLYALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFVFWRKLFQGLDIWLKLSVGFFPTGVIGFFVAKYLNALFNGWVVVGMLIFGGVMFILIEFAHKNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLLAIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFGIYRIILGFVFFYLYYSGILNAGSEFKL
Sequence Length
267
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,725 Da
NCBI Official Full Name
putative undecaprenol kinase
NCBI Official Symbol
JJD26997_0215
NCBI Protein Information
putative undecaprenol kinase
UniProt Protein Name
Undecaprenyl-diphosphatase
UniProt Gene Name
uppP
UniProt Entry Name
UPPP_CAMJD
Uniprot Description
Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin
By similarity. HAMAP-Rule MF_01006
Catalytic activity: Ditrans,octacis-undecaprenyl diphosphate + H2O = ditrans,octacis-undecaprenyl phosphate + phosphate. HAMAP-Rule MF_01006
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01006.
Miscellaneous: Bacitracin is thought to be involved in the inhibition of peptidoglycan synthesis by sequestering undecaprenyl diphosphate, thereby reducing the pool of lipid carrier available. HAMAP-Rule MF_01006
Sequence similarities: Belongs to the UppP family.
Similar Products
Product Notes
The JJD26997_0215 uppp (Catalog #AAA1038560) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-267. The amino acid sequence is listed below: MGNLYALILG IIEGLTEFLP VSSTGHMILG TTILGIDIDE FWKSFLIIIQ LGSILAVIFV FWRKLFQGLD IWLKLSVGFF PTGVIGFFVA KYLNALFNGW VVVGMLIFGG VMFILIEFAH KNKQYRINSL EEISFKQAFC IGIFQSLAMI PGTSRSGASI IGGLLLGFNR KVAAEFSFLL AIPTMIIATA YSIYKEPELL SNANSLIPLG IGFITAFVVA VLVIKFFLKF ISKFDFIPFG IYRIILGFVF FYLYYSGILN AGSEFKL. It is sometimes possible for the material contained within the vial of "Undecaprenyl-diphosphatase (uppP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
