Protein umuD (umuD) Recombinant Protein | umuD recombinant protein

Recombinant Escherichia coli Protein umuD (umuD)

Cat. Num. AAA1069473

• Gene Names: umuD; ECK1171; JW1172
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein umuD (umuD); Recombinant Escherichia coli Protein umuD (umuD); umuD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-139, full length protein
• Sequence: MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR
• Sequence Length: 139

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16129146
• NCBI GeneID: 945746
• NCBI Accession #: NP_415701.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AG11; P04153
• Molecular Weight: 15,063 Da
• NCBI Official Full Name: translesion error-prone DNA polymerase V subunit; RecA-activated auto-protease
• NCBI Official Symbol: umuD
• NCBI Official Synonym Symbols: ECK1171; JW1172
• NCBI Protein Information: translesion error-prone DNA polymerase V subunit; RecA-activated auto-protease
• UniProt Protein Name: Protein UmuD
• Protein Family: Protein
• UniProt Gene Name: umuD
• UniProt Synonym Gene Names: Pol V

NCBI Description

LexA regulon. [More information is available at EcoGene: EG11057]. Following induction of the SOS response, UmuD is proteolytically processed into UmuD' in a cleavage reaction that depends on activated RecA . [More information is available at EcoCyc: EG11057].

Uniprot Description

Involved in UV protection and mutation. Poorly processive, error-prone DNA polymerase involved in translesion repair (PubMed:10801133). Essential for induced (or SOS) mutagenesis. Able to replicate DNA across DNA lesions (thymine photodimers and abasic sites, called translesion synthesis) in the presence of activated RecA; efficiency is maximal in the presence of the beta sliding-clamp and clamp-loading complex of DNA polymerase III plus single-stranded binding protein (SSB) (PubMed:10801133). RecA and to a lesser extent the beta clamp-complex may target Pol V to replication complexes stalled at DNA template lesions (PubMed:10801133).