Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Virion egress protein UL34 (UL34) Recombinant Protein | UL34 recombinant protein

Recombinant Human herpesvirus 1 Virion egress protein UL34 (UL34)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Virion egress protein UL34 (UL34); Recombinant Human herpesvirus 1 Virion egress protein UL34 (UL34); Recombinant Virion egress protein UL34 (UL34); Virion egress protein UL34; Primary envelopment factor UL34; UL34 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-275
Sequence
MAGLGKPYTGHPGDAFEGLVQRIRLIVPSTLRGGDGEAGPYSPSSLPSRCAFQFHGHDGSDESFPIEYVLRLMNDWAEVPCNPYLRIQNTGVSVLFQGFFHRPHNAPGGAITPERTNVILGSTETTGLSLGDLDTIKGRLGLDARPMMASMWISCFVRMPRVQLAFRFMGPEDAGRTRRILCRAAEQAITRRRRTRRSREAYGAEAGLGVAGTGFRARGDGFGPLPLLTQGPSRPWHQALRGLKHLRIGPPALVLAAGLVLGAAIWWVVGAGARL
Sequence Length
275
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,790 Da
NCBI Official Full Name
nuclear egress membrane protein
NCBI Official Symbol
UL34
NCBI Protein Information
type 2 membrane protein; interacts with nuclear egress lamina protein; nuclear egress membrane protein
UniProt Protein Name
Virion egress protein UL34
Protein Family
UniProt Gene Name
UL34
UniProt Entry Name
UL34_HHV11

Uniprot Description

Function: Plays a major role in virion nuclear egress, the first step of virion release from infected cell. Viral capsids are initially assembled within the nucleus, UL31/UL34 complex induces capsids budding and envelopment into the perinuclear space. Then UL31/UL34 complex promotes fusion of perinuclear virion envelope with the outer nuclear membrane, releasing viral capsid into the cytoplasm where it will engages budding sites in the Golgi or trans-Golgi network. Ref.4 Ref.5 Ref.7

Subunit structure: Forms a complex with UL31, which interacts with glycoprotein D. This interaction recruits glycoprotein D and glycoprotein M to the inner nuclear membrane. Ref.2 Ref.8 Ref.10 Ref.11

Subcellular location: Host nucleus inner membrane; Single-pass membrane protein. Note: Localizes also at the transient membrane of perinuclear virions. Ref.3 Ref.9

Post-translational modification: Phosphorylated by viral kinase US3. Ref.6

Sequence similarities: Belongs to the herpesviridae UL34 family.

Research Articles on UL34

Similar Products

Product Notes

The UL34 ul34 (Catalog #AAA1077720) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-275. The amino acid sequence is listed below: MAGLGKPYTG HPGDAFEGLV QRIRLIVPST LRGGDGEAGP YSPSSLPSRC AFQFHGHDGS DESFPIEYVL RLMNDWAEVP CNPYLRIQNT GVSVLFQGFF HRPHNAPGGA ITPERTNVIL GSTETTGLSL GDLDTIKGRL GLDARPMMAS MWISCFVRMP RVQLAFRFMG PEDAGRTRRI LCRAAEQAIT RRRRTRRSRE AYGAEAGLGV AGTGFRARGD GFGPLPLLTQ GPSRPWHQAL RGLKHLRIGP PALVLAAGLV LGAAIWWVVG AGARL. It is sometimes possible for the material contained within the vial of "Virion egress protein UL34 (UL34), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.