Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Spleen )

Rabbit anti-Human, Pig ASGR2 Polyclonal Antibody | anti-ASGR2 antibody

ASGR2 antibody - N-terminal region

Gene Names
ASGR2; HL-2; HBXBP; ASGPR2; ASGP-R2; CLEC4H2
Reactivity
Human, Pig
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ASGR2; Polyclonal Antibody; ASGR2 antibody - N-terminal region; anti-ASGR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
Sequence Length
311
Applicable Applications for anti-ASGR2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%; Pig: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ASGR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Spleen )

Immunohistochemistry (IHC) (Human Spleen )

Western Blot (WB)

(Host: RabbitTarget Name: ASGR2Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR2Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ASGR2 Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysateASGR2 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-ASGR2 Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysateASGR2 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ASGR2 antibody
This is a rabbit polyclonal antibody against ASGR2. It was validated on Western Blot and immunohistochemistry

Target Description: ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.
Product Categories/Family for anti-ASGR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
433
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
asialoglycoprotein receptor 2 isoform a
NCBI Official Synonym Full Names
asialoglycoprotein receptor 2
NCBI Official Symbol
ASGR2
NCBI Official Synonym Symbols
HL-2; HBXBP; ASGPR2; ASGP-R2; CLEC4H2
NCBI Protein Information
asialoglycoprotein receptor 2
UniProt Protein Name
Asialoglycoprotein receptor 2
UniProt Gene Name
ASGR2
UniProt Synonym Gene Names
CLEC4H2; ASGP-R 2; ASGPR 2; HL-2
UniProt Entry Name
ASGR2_HUMAN

NCBI Description

This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

ASGP-R: cell surface receptor that mediates the endocytosis of plasma glycoproteins in which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p

Cellular Component: integral to membrane

Molecular Function: protein binding; asialoglycoprotein receptor activity; carbohydrate binding

Biological Process: receptor-mediated endocytosis; cell surface receptor linked signal transduction; glycoprotein metabolic process; lipid homeostasis; regulation of protein stability; bone mineralization

Research Articles on ASGR2

Similar Products

Product Notes

The ASGR2 asgr2 (Catalog #AAA3201738) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASGR2 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's ASGR2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ASGR2 asgr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STLTEVQAIS THGGSVGDKI TSLGAKLEKQ QQDLKADHDA LLFHLKHFPV. It is sometimes possible for the material contained within the vial of "ASGR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.