Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UDP-glucuronosyltransferase 2B17 (Ugt2b17) Recombinant Protein | Ugt2b17 recombinant protein

Recombinant Rat UDP-glucuronosyltransferase 2B17 (Ugt2b17)

Gene Names
Ugt2b17; Udpgt; Rlug38; Ugt2b3; Ugt2b5; Udpgtr-3; UDPGT 2B5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-glucuronosyltransferase 2B17 (Ugt2b17); Recombinant Rat UDP-glucuronosyltransferase 2B17 (Ugt2b17); Ugt2b17 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-530aa; Full length protein
Sequence
GKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSAYYVLDPKKSPDLKFETFPTSVSK DELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGFSDYYLSLCKDTVSNKQLMAKLQE SKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYKIEKSSGRFILPPSYVPVILSGMG GPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEILGRPTTLAETMGKAEMWLIRSYW DLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSSGEHGVVVFSLGSMVSSMTEEKAN AIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHSGANGVYE AIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRTMSKSDLFNALKEIINNPFYKKNA VWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPLGHDLPWYQYHSLDVIGFLLTCSA VIAVLTVKCFLFIYRLFVKKEKKMKNE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ugt2b17 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,525 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 2B17
NCBI Official Synonym Full Names
UDP glucuronosyltransferase 2 family, polypeptide B15
NCBI Official Symbol
Ugt2b17
NCBI Official Synonym Symbols
Udpgt; Rlug38; Ugt2b3; Ugt2b5; Udpgtr-3; UDPGT 2B5
NCBI Protein Information
UDP-glucuronosyltransferase 2B17
UniProt Protein Name
UDP-glucuronosyltransferase 2B17
UniProt Gene Name
Ugt2b17
UniProt Synonym Gene Names
Ugt2b3; Ugt2b5; UDPGT 2B17; UDPGT 2B5
UniProt Entry Name
UDB17_RAT

NCBI Description

enzyme which glucuronidates testosterone, dihydrotestosterone, and beta-estradiol [RGD, Feb 2006]

Uniprot Description

UGT2B17: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The major substrates of this isozyme are eugenol > 4-methylumbelliferone > dihydrotestosterone (DHT) > androstane-3-alpha,17-beta-diol (3-alpha-diol) > testosterone > androsterone (ADT). Belongs to the UDP-glycosyltransferase family.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; Cofactor and Vitamin Metabolism - retinol; Carbohydrate Metabolism - starch and sucrose; EC 2.4.1.17; Lipid Metabolism - androgen and estrogen; Mitochondrial; Carbohydrate Metabolism - pentose and glucuronate interconversions; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase; Membrane protein, integral; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Carbohydrate Metabolism - ascorbate and aldarate

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: glucuronosyltransferase activity; retinoic acid binding

Biological Process: response to lipopolysaccharide

Similar Products

Product Notes

The Ugt2b17 ugt2b17 (Catalog #AAA7032823) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-530aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ugt2b17 ugt2b17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKVLVWPMEF SHWMNIKTIL DELVQRGHEV TVLKPSAYYV LDPKKSPDLK FETFPTSVSK DELENYFIKL VDVWTYELQR DTCLSYSPLL QNMIDGFSDY YLSLCKDTVS NKQLMAKLQE SKFDVLLSDP VAACGELIAE VLHIPFLYSL RFSPGYKIEK SSGRFILPPS YVPVILSGMG GPMTFIDRVK NMICTLYFDF WFHMFNAKKW DPFYSEILGR PTTLAETMGK AEMWLIRSYW DLEFPHPTLP NVDYIGGLQC RPPKPLPKDM EDFVQSSGEH GVVVFSLGSM VSSMTEEKAN AIAWALAQIP QKVLWKFDGK TPATLGPNTR VYKWLPQNDL LGHPKTKAFV THSGANGVYE AIYHGIPMVG IPMFGEQHDN IAHMVAKGAA VTLNIRTMSK SDLFNALKEI INNPFYKKNA VWLSTIHHDQ PMKPLDKAVF WIEFVMRHKG AKHLRPLGHD LPWYQYHSLD VIGFLLTCSA VIAVLTVKCF LFIYRLFVKK EKKMKNE. It is sometimes possible for the material contained within the vial of "UDP-glucuronosyltransferase 2B17 (Ugt2b17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.